From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006241000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 6304092..6306822
  • synteny block?: BlockID0049650
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2510
    08BA02176:
    C248_2631
    11819-97:
    MS7_2579
    71193:
    ST398NM01_2623
    ECT-R 2:
    ECTR2_2427
    ED133:
    SAOV_2617
    ED98:
    SAAV_2639
    HO 5096 0412:
    SAEMRSA15_24750
    JH1:
    SaurJH1_2649
    JH9:
    SaurJH9_2595
    JKD6008:
    SAA6008_02611
    JKD6159:
    SAA6159_02470
    LGA251:
    SARLGA251_23470
    M013:
    M013TW_2547
    MRSA252:
    SAR2653
    MSHR1132:
    MSSA476:
    SAS2459
    Mu3:
    SAHV_2556
    Mu50:
    SAV2572
    MW2:
    MW2493
    RF122:
    SAB2446
    ST398:
    SAPIG2623
    T0131:
    SAT0131_02784 (icaC)
    TCH60:
    HMPREF0772_10618
    TW20:
    SATW20_26930
    USA300_TCH1516:
    USA300HOU_2567
    VC40:
    SAVC_11740

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTSIFVFAYLNNTSGNMLFRQQMICACLLANVRHSSIVCLNNICCIVDMRCLNTKIGGID
    N315            ------------------------------------------------------------
    NCTC8325        MTSIFVFAYLNNTSGNMLFRQQMICACLLANVRHSSIVCLNNICCIVDMRCLNTKIGGID
    Newman          ------------------------------------------------MRCLNTKIGGID
    USA300_FPR3757  MTSIFVFAYLNNTSGNMLFRQQMICACLLANVRHSSIVCLNNICCIVDMRCLNTKIGGID
                                                                                

    COL             VSETDEPQGFERTHNILNINQSSLGVVTYITNKLKSTLKQHIIIARGKKRIDYRLSYNFY
    N315            MSETDEPQGFERTHNILNINQSSLGVVTYITNKLKSTLKQHIIIARGKKRIDYRLSYNFY
    NCTC8325        VSETDEPQGFERTHNILNINQSSLGVVTYITNKLKSTLKQHIIIARGKKRIDYRLSYNFY
    Newman          VSETDEPQGFERTHNILNINQSSLGVVTYITNKLKSTLKQHIIIARGKKRIDYRLSYNFY
    USA300_FPR3757  VSETDEPQGFERTHNILNINQSSLGVVTYITNKLKSTLKQHIIIARGKKRIDYRLSYNFY
                    :***********************************************************

    COL             TTYYDNVEIKKIDCEYTYAMPIAILIRHTMSFDNAHFFAQLRHPVL
    N315            TTYYDNVEIKKIDCEYTYAMPIAILIRHTMSFDNAHFFAQLRHPVL
    NCTC8325        TTYYDNVEIKKIDCEYTYAMPIAILIRHTMSFDNAHFFAQLRHPVL
    Newman          TTYYDNVEIKKIDCEYTYAMPIAILIRHTMSFDNAHFFAQLRHPVL
    USA300_FPR3757  TTYYDNVEIKKIDCEYTYAMPIAILIRHTMSFDNAHFFAQLRHPVL
                    **********************************************