From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006245000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 6307066..6307296
  • synteny block?: BlockID0049680
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2511
    08BA02176:
    C248_2632
    11819-97:
    MS7_2580
    71193:
    ST398NM01_2624
    ECT-R 2:
    ECTR2_2428
    ED133:
    SAOV_2618
    ED98:
    SAAV_2640
    HO 5096 0412:
    SAEMRSA15_24760
    JH1:
    SaurJH1_2650
    JH9:
    SaurJH9_2596
    JKD6008:
    SAA6008_02612
    JKD6159:
    SAA6159_02471
    LGA251:
    SARLGA251_23480
    M013:
    M013TW_2548
    MRSA252:
    SAR2654
    MSHR1132:
    SAMSHR1132_23890
    MSSA476:
    SAS2460
    Mu3:
    SAHV_2557
    Mu50:
    SAV2573
    MW2:
    MW2494
    RF122:
    SAB2447
    ST398:
    SAPIG2624
    T0131:
    SAT0131_02785 (lip)
    TCH60:
    HMPREF0772_10617
    TW20:
    SATW20_26940
    USA300_TCH1516:
    USA300HOU_2568
    VC40:
    SAVC_11745

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKILDRINELANKEKVQPLTVAEKQEQHALRQDYLSMIRGQVLTTFSTIKVVDPIGQDVT
    N315            MKILDRINELANKEKVQPLTVAEKQEQHALRQDYLSMIRGQVLTTFSTIKVVDPIGQDVT
    NCTC8325        MKILDRINELANKEKVQPLTVAEKQEQHALRQDYLSMIRGQVLTTFSTIKVVDPIGQDVT
    Newman          MKILDRINELANKEKVQPLTVAEKQEQHALRQDYLSMIRGQVLTTFSTIKVVDPIGQDVT
    USA300_FPR3757  MKILDRINELANKEKVQPLTVAEKQEQHALRQDYLSMIRGQVLTTFSTIKVVDPIGQDVT
                    ************************************************************

    COL             PDKVYDLRQQYGYIQN
    N315            PDKVYDLRQQYGYIQN
    NCTC8325        PDKVYDLRQQYGYIQN
    Newman          PDKVYDLRQQYGYIQN
    USA300_FPR3757  PDKVYDLRQQYGYIQN
                    ****************