From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006251000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 6309030..6309329
  • synteny block?: BlockID0049740
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2515
    08BA02176:
    C248_2635
    11819-97:
    MS7_2583
    71193:
    ST398NM01_2627
    ECT-R 2:
    ECTR2_2431
    ED133:
    SAOV_2621c
    ED98:
    SAAV_2643
    HO 5096 0412:
    SAEMRSA15_24790
    JH1:
    SaurJH1_2653
    JH9:
    SaurJH9_2599
    JKD6008:
    SAA6008_02615
    JKD6159:
    SAA6159_02474
    LGA251:
    SARLGA251_23510
    M013:
    M013TW_2551
    MRSA252:
    SAR2657
    MSHR1132:
    SAMSHR1132_23920
    MSSA476:
    SAS2463
    Mu3:
    SAHV_2561
    Mu50:
    SAV2577
    MW2:
    MW2497
    RF122:
    SAB2451c
    ST398:
    SAPIG2627
    T0131:
    SAT0131_02788
    TCH60:
    HMPREF0772_10614
    TW20:
    SATW20_26970
    USA300_TCH1516:
    USA300HOU_2571
    VC40:
    SAVC_11760

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSLNKEQRRITAEELQAHFEASTLSVQMIAEKLNVTTEDVEKVLAMTAPLGIFSHQLQRF
    N315            MSLNKEQRRITAEELQAHFEESTLSVQMIAEKLNVTTEDVEKVLAMTAPLGIFSHQLQRF
    NCTC8325        MSLNKEQRRITAEELQAHFEASTLSVQMIAEKLNVTTEDVEKVLAMTAPLGIFSHQLQRF
    Newman          MSLNKEQRRITAEELQAHFEASTLSVQMIAEKLNVTTEDVEKVLAMTAPLGIFSHQLQRF
    USA300_FPR3757  MSLNKEQRRITAEELQAHFEASTLSVQMIAEKLNVTTEDVEKVLAMTAPLGIFSHQLQRF
                    ******************** ***************************************

    COL             IHLVWDVRDVINDNIKGNGQTPEPYTYLKGEKEDYWFLR
    N315            IHLVWDVRDVINDNIKGNGQTPEPYTYLKGEKEDYWFLR
    NCTC8325        IHLVWDVRDVINDNIKGNGQTPEPYTYLKGEKEDYWFLR
    Newman          IHLVWDVRDVINDNIKGNGQTPEPYTYLKGEKEDYWFLR
    USA300_FPR3757  IHLVWDVRDVINDNIKGNGQTPEPYTYLKGEKEDYWFLR
                    ***************************************