From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006252000
  • symbol?:
  • description?: TetR family transcriptional regulator

      descriptions from strain specific annotations:

    • TetR family transcriptional regulator
    • Transcriptional regulator, TetR family
    • regulatory proteins, tetR family protein
    • TetR family regulatory protein
    • transcriptional regulator TetR family protein
    • bacterial regulatory s, tetR family protein
    • HTH-type transcriptional regulator
  • strand?: +
  • coordinates?: 6309428..6310020
  • synteny block?: BlockID0049750
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2516 (acrR)
    08BA02176:
    C248_2636
    11819-97:
    MS7_2584
    71193:
    ST398NM01_2628
    ECT-R 2:
    ECTR2_2432
    ED133:
    SAOV_2622
    ED98:
    SAAV_2644
    HO 5096 0412:
    SAEMRSA15_24800
    JH1:
    SaurJH1_2654
    JH9:
    SaurJH9_2600
    JKD6008:
    SAA6008_02616
    JKD6159:
    SAA6159_02475
    LGA251:
    SARLGA251_23520
    M013:
    M013TW_2552
    MRSA252:
    SAR2658
    MSHR1132:
    SAMSHR1132_23930
    MSSA476:
    SAS2464
    Mu3:
    SAHV_2562
    Mu50:
    SAV2578
    MW2:
    MW2498
    RF122:
    SAB2452
    ST398:
    SAPIG2628
    T0131:
    SAT0131_02789
    TCH60:
    HMPREF0772_10613
    TW20:
    SATW20_26980
    USA300_TCH1516:
    USA300HOU_2572
    VC40:
    SAVC_11765

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRKDAKENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDLCYYVIQ
    N315            MRKDAKENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDLCYYVIQ
    NCTC8325        MRKDAKENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDLCYYVIQ
    Newman          MRKDAKENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDLCYYVIQ
    USA300_FPR3757  MRKDAKENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDLCYYVIQ
                    ************************************************************

    COL             RDLDIFITHFKQIKDDYHSNYEVMQVSLDYLLQFKIDNKALLQCIEAGNNKLRFYQSAFY
    N315            RDLDIFITHFKQIKDDYHSNYEVMQVSLDYLLQFKIDNKALLQCIEAGNNKLRFYQSAFY
    NCTC8325        RDLDIFITHFKQIKDDYHSNYEVMQVSLDYLLQFKIDNKALLQCIEAGNNKLRFYQSAFY
    Newman          RDLDIFITHFKQIKDDYHSNYEVMQVSLDYLLQFKIDNKALLQCIEAGNNKLRFYQSAFY
    USA300_FPR3757  RDLDIFITHFKQIKDDYHSNYEVMQVSLDYLLQFKIDNKALLQCIEAGNNKLRFYQSAFY
                    ************************************************************

    COL             QELFDFYYDLFKSDDDTYTKFKTDMLLQSLSTSVFAFQIEHRHISIEAYRNYLLNIYLDE
    N315            QELFDFYYDLFKSDDDTYTKFKTDMLLQSLSTSVFAFQIEHRHISIEAYRNYLLNIYLDE
    NCTC8325        QELFDFYYDLFKSDDDTYTKFKTDMLLQSLSTSVFAFQIEHRHISIEAYRNYLLNIYLDE
    Newman          QELFDFYYDLFKSDDDTYTKFKTDMLLQSLSTSVFAFQIEHRHISIEAYRNYLLNIYLDE
    USA300_FPR3757  QELFDFYYDLFKSDDDTYTKFKTDMLLQSLSTSVFAFQIEHRHISIEAYRNYLLNIYLDE
                    ************************************************************

    COL             VGRND
    N315            VERND
    NCTC8325        VGRND
    Newman          VGRND
    USA300_FPR3757  VGRND
                    * ***