From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006255000
  • symbol?:
  • description?: amidohydrolase

      descriptions from strain specific annotations:

    • amidohydrolase
    • amidohydrolase family protein
    • 5-carboxyvanillic acid decarboxylase
    • amidohydrolase 2
    • o-pyrocatechuate decarboxylase
    • pseudogene
  • strand?: +
  • coordinates?: 6310791..6311816
  • synteny block?: BlockID0049780
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2518
    08BA02176:
    C248_2639
    11819-97:
    MS7_2586
    71193:
    ST398NM01_2630
    ECT-R 2:
    ECTR2_2434
    ED133:
    SAOV_2625
    ED98:
    SAAV_2646
    HO 5096 0412:
    SAEMRSA15_24820
    JH1:
    SaurJH1_2656
    JH9:
    SaurJH9_2602
    JKD6008:
    SAA6008_02618
    JKD6159:
    SAA6159_02477
    LGA251:
    SARLGA251_23540
    M013:
    M013TW_2554
    MRSA252:
    SAR2660
    MSHR1132:
    SAMSHR1132_23950
    MSSA476:
    SAS2466
    Mu3:
    SAHV_2564
    Mu50:
    SAV2580
    MW2:
    MW2500
    RF122:
    SAB2454
    ST398:
    SAPIG2630
    T0131:
    SAT0131_02792 (hisI)
    TCH60:
    HMPREF0772_10611
    TW20:
    SATW20_27000
    USA300_TCH1516:
    USA300HOU_2574
    VC40:
    SAVC_11775

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKSITFEEHYVIEDIQKETMNAISADPKGVPMKVMLEGLEKKTGFTNADELSHHDERIQF
    N315            MKSITFEEHYVIEDIQKETMNAISADPKGVPMKVMLEGLEKKTGFTNADELSHHDERIQF
    NCTC8325        MKSITFEEHYVIEDIQKETMNAISADPKGVPMKVMLEGLEKKTGFTNADELSHHDERIQF
    Newman          MKSITFEEHYVIEDIQKETMNAISADPKGVPMKVMLEGLEKKTGFTNADELSHHDERIQF
    USA300_FPR3757  MKSITFEEHYVIEDIQKETMNAISADPKGVPMKVMLEGLEKKTGFTNADELSHHDERIQF
                    ************************************************************

    COL             MNNQDVQIQVLSYGNGSPSNLVGQKAIELCQKANDQLANYIAQYPNRFVGFATLPINEPE
    N315            MNNQDVQIQVLSYGNGSPSNLVGQKAIELCQKANDQLANYIAQYPNRFVGFATLPINEPE
    NCTC8325        MNNQDVQIQVLSYGNGSPSNLVGQKAIELCQKANDQLANYIAQYPNRFVGFATLPINEPE
    Newman          MNNQDVQIQVLSYGNGSPSNLVGQKAIELCQKANDQLANYIAQYPNRFVGFATLPINEPE
    USA300_FPR3757  MNNQDVQIQVLSYGNGSPSNLVGQKAIELCQKANDQLANYIAQYPNRFVGFATLPINEPE
                    ************************************************************

    COL             AAAREFERCINDLGFKGALIMGRAQDGFLDQDKYDIIFKTAENLDVPIYLHPAPVNSDIY
    N315            AAAREFERCINDLGFKGALIMGRAQDGFLDQDKYDIIFKTAENLDVPIYLHPAPVNSDIY
    NCTC8325        AAAREFERCINDLGFKGALIMGRAQDGFLDQDKYDIIFKTAENLDVPIYLHPAPVNSDIY
    Newman          AAAREFERCINDLGFKGALIMGRAQDGFLDQDKYDIIFKTAENLDVPIYLHPAPVNSDIY
    USA300_FPR3757  AAAREFERCINDLGFKGALIMGRAQDGFLDQDKYDIIFKTAENLDVPIYLHPAPVNSDIY
                    ************************************************************

    COL             QSYYKGNYPEVTAATFACFGYGWHIDVGIHAIHLVLSGIFDRYPKLNMIIGHWGEFIPFF
    N315            QSYYKGNYPEVTAATFACFGYGWHIDVGIHAIHLVLSGIFDRYPKLNMIIGHWGEFIPFF
    NCTC8325        QSYYKGNYPEVTAATFACFGYGWHIDVGIHTIHLVLSGIFDRYPKLNMIIGHWGEFIPFF
    Newman          QSYYKGNYPEVTAATFACFGYGWHIDVGIHAIHLVLSGIFDRYPKLNMIIGHWGEFIPFF
    USA300_FPR3757  QSYYKGNYPEVTAATFACFGYGWHIDVGIHAIHLVLSGIFDRYPKLNMIIGHWGEFIPFF
                    ******************************:*****************************

    COL             LERMDEALFTEHLNHPVSYYFKNNFYITPSGMLTKPQFDLVKKEVGIDRILYAADYPYIE
    N315            LERMDEALFAEHLNHSVSYYFKNSFYITPSGMLTKPQFDLVKKEVGIDRILYAADYPYIE
    NCTC8325        LERMDEALFAEHLNHPVSYYFKNNFYITPSGMLTKPQFDLVKKEVGIDRILYAADYPYIE
    Newman          LERMDEALFTEHLNHPVSYYFKNNFYITPSGMLTKPQFDLVKKEVGIDRILYAADYPYIE
    USA300_FPR3757  LERMDEALFAEHLNHPVSYYFKNNFYITPSGMLTKPQFDLVKKEVGIDRILYAADYPYIE
                    *********:*****.*******.************************************

    COL             PEKLGVFLDELGLTDEEKEKISYTNGAKLLGLSPNN
    N315            PEKLGVFLDELGLTDEEKEKISYTNGAKLLGLSSNN
    NCTC8325        PEKLGVFLDELGLTDEEKEKISYTNGAKLLGLSPNN
    Newman          PEKLGVFLDELGLTDEEKEKISYTNGAKLLGLSPNN
    USA300_FPR3757  PEKLGVFLDELGLTDEEKEKISYTNGAKLLGLSPNN
                    *********************************.**