From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006264000
  • symbol?:
  • description?: type II secretion protein

      descriptions from strain specific annotations:

    • type II secretion protein
    • esaC protein
    • IS200 family transposase
    • putative EsaC protein
    • Putative EsaC protein analog (Listeria type 3)
  • strand?: -
  • coordinates?: 6318221..6318517
  • synteny block?: BlockID0049870
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2523 (esaC)
    08BA02176:
    C248_2645
    11819-97:
    MS7_2591
    71193:
    ST398NM01_2635
    ECT-R 2:
    ECTR2_2439
    ED133:
    SAOV_2630c
    ED98:
    SAAV_2651
    HO 5096 0412:
    SAEMRSA15_24880
    JH1:
    SaurJH1_2661
    JH9:
    SaurJH9_2607
    JKD6008:
    SAA6008_02644
    JKD6159:
    SAA6159_02482
    LGA251:
    SARLGA251_23590
    M013:
    M013TW_2559
    MRSA252:
    SAR2665
    MSHR1132:
    SAMSHR1132_24000
    MSSA476:
    SAS2471
    Mu3:
    SAHV_2569
    Mu50:
    SAV2585
    MW2:
    MW2505
    RF122:
    SAB2460c
    ST398:
    SAPIG2635
    T0131:
    SAT0131_02819
    TCH60:
    HMPREF0772_10606
    TW20:
    SATW20_27260
    USA300_TCH1516:
    USA300HOU_2579
    VC40:
    SAVC_11805

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             METIGSIIYLKEGSQKLMIINRGPIVEIENQKYMFDYSACKYPIGVVEDEIYYFNEENID
    N315            METIGSIIYLKEGSQKLMIINRGPIVEIENQKYMFDYSACKYPIGVVEDEIYYFNEENID
    NCTC8325        METIGSIIYLKEGSQKLMIINRGPIVEIENQKYMFDYSACKYPIGVVEDEIYYFNEENID
    Newman          METIGSIIYLKEGSQKLMIINRGPIVEIENQKYMFDYSACKYPIGVVEDEIYYFNEENID
    USA300_FPR3757  METIGSIIYLKEGSQKLMIINRGPIVEIENQKYMFDYSACKYPIGVVEDEIYYFNEENID
                    ************************************************************

    COL             SVIFKGYSDQDEVRFQELFENMKQNLDSEIQRGEVTQQ
    N315            SVIFKGYSDQDEVRFQELFENMKQNLDSEIQRGEVTPQ
    NCTC8325        SVIFKGYSDQDEVRFQELFENMKQNLDSEIQRGEVTQQ
    Newman          SVIFKGYSDQDEVRFQELFENMKQNLDSEIQRGEVTQQ
    USA300_FPR3757  SVIFKGYSDQDEVRFQELFENMKQNLDSEIQRGEVTQQ
                    ************************************ *