From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006270000
  • symbol?:
  • description?: membrane protein
  • strand?: +
  • coordinates?: 6321814..6322089
  • synteny block?: BlockID0049930
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2528
    08BA02176:
    C248_2651
    11819-97:
    MS7_2596
    71193:
    ST398NM01_2640
    ECT-R 2:
    ECTR2_2444
    ED133:
    SAOV_2635
    ED98:
    SAAV_2656
    HO 5096 0412:
    SAEMRSA15_24930
    JH1:
    SaurJH1_2666
    JH9:
    SaurJH9_2612
    JKD6008:
    SAA6008_02649
    JKD6159:
    SAA6159_02487
    LGA251:
    SARLGA251_23640
    M013:
    M013TW_2564
    MRSA252:
    SAR2670
    MSHR1132:
    SAMSHR1132_24050
    MSSA476:
    SAS2476
    Mu3:
    SAHV_2574
    Mu50:
    SAV2590
    MW2:
    MW2510
    RF122:
    SAB2465
    ST398:
    SAPIG2640
    T0131:
    SAT0131_02824
    TCH60:
    HMPREF0772_10601
    TW20:
    SATW20_27310
    USA300_TCH1516:
    USA300HOU_2584
    VC40:
    SAVC_11830

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKETDNKKTVATSDNKDTQQQNQPEEDERQGLNGYRKTDLDLEIEQELREMMKTGENET
    N315            MTKETDNKKTVATSDNKDTQQQNQTEEDERQGLNGYRKTDLDLEIEQELREMMKTGENET
    NCTC8325        MTKETDNKKTVATSDNKDTQQQNQPEEDERQGLNGYRKTDLDLEIEQELREMMKTGENET
    Newman          MTKETDNKKTVATSDNKDTQQQNQPEEDERQGLNGYRKTDLDLEIEQELREMMKTGENET
    USA300_FPR3757  MTKETDNKKTVATSDNKDTQQQNQPEEDERQGLNGYRKTDLDLEIEQELREMMKTGENET
                    ************************.***********************************

    COL             KNDYKKFKVFSLISTLVIVILAIIRFVHKMM
    N315            KNDYKKFKVFSLISTLVIVILAIIRFVHKMI
    NCTC8325        KNDYKKFKVFSLISTLVIVILAIIRFVHKMM
    Newman          KNDYKKFKVFSLISTLVIVILAIIRFVHKMM
    USA300_FPR3757  KNDYKKFKVFSLISTLVIVILAIIRFVHKMM
                    ******************************: