From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006275000
  • symbol?:
  • description?: TetR/AcrR family transcriptional regulator

      descriptions from strain specific annotations:

    • TetR/AcrR family transcriptional regulator
    • TetR family transcriptional regulator
    • transcriptional regulator TetR family protein
    • bacterial regulatory s, tetR family protein
    • DNA-binding protein
    • putative DNA-binding protein
    • putative TetR-family transcriptional regulator
    • TetR family regulatory protein
    • Transcriptional regulator, TetR family
    • transcriptional regulators, AcrR family
  • strand?: -
  • coordinates?: 6325909..6326496
  • synteny block?: BlockID0049980
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2531
    08BA02176:
    C248_2654
    11819-97:
    MS7_2599
    71193:
    ST398NM01_2643
    ECT-R 2:
    ECTR2_2447
    ED133:
    SAOV_2638c
    ED98:
    SAAV_2659
    HO 5096 0412:
    SAEMRSA15_24960
    JH1:
    SaurJH1_2669
    JH9:
    SaurJH9_2615
    JKD6008:
    SAA6008_02652
    JKD6159:
    SAA6159_02490
    LGA251:
    SARLGA251_23670
    M013:
    M013TW_2567
    MRSA252:
    SAR2673
    MSHR1132:
    SAMSHR1132_24090
    MSSA476:
    SAS2479
    Mu3:
    SAHV_2577
    Mu50:
    SAV2593
    MW2:
    MW2513
    RF122:
    SAB2468c
    ST398:
    SAPIG2643
    T0131:
    SAT0131_02827
    TCH60:
    HMPREF0772_10598
    TW20:
    SATW20_27340
    USA300_TCH1516:
    USA300HOU_2588
    VC40:
    SAVC_11845

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTIDRRIRKSQVAMRNAFIELLHQHQLEEITVQQIADLADVNRSTFYTHYYDKYDLLEKL
    N315            MTIDRRIRKSQVAMRNAFIELLHQHQLEEITVQQIADLADVNRSTFYTHYYDKYDLLEKL
    NCTC8325        MTIDRRIRKSQVAMRNAFIELLHQHQLEEITVQQIADLADVNRSTFYTHYYDKYDLLEKL
    Newman          MTIDRRIRKSQVAMRNAFIELLHQHQLEEITVQQIADLADVNRSTFYTHYYDKYDLLEKL
    USA300_FPR3757  MTIDRRIRKSQVAMRNAFIELLHQHQLEEITVQQIADLADVNRSTFYTHYYDKYDLLEKL
                    ************************************************************

    COL             EDQQLEEIRDFIHDEKLNGAVKLSTDNIHQIMTVLIEMIEKDIAFYQLMFRMGKDSNIHE
    N315            EDQQLEEIRDFIHDEKLNGAVKLSTDNIHQIMTVLIDMIEKDIAFYQLMFRMGKDSNIHE
    NCTC8325        EDQQLEEIRDFIHDEKLNGAVKLSTDNIHQIMTVLIEMIEKDIAFYQLMFRMGKDSNIHE
    Newman          EDQQLEEIRDFIHDEKLNGAVKLSTDNIHQIMTVLIEMIEKDIAFYQLMFRMGKDSNIHE
    USA300_FPR3757  EDQQLEEIRDFIHDEKLNGAVKLSTDNIHQIMTVLIEMIEKDIAFYQLMFRMGKDSNIHE
                    ************************************:***********************

    COL             KLYDLIMCHLQRYKNENDQINGIPFSYFMSYVSGAGLSFIRHWVEDPNRIDKVDLIRHFN
    N315            KLYDLIMCHLQRYKNENDQINGIPFSYFMSYVSGAGLSLIRHWVEDPNRIDKVDLIMHFN
    NCTC8325        KLYDLIMCHLQRYKNENDQINGIPFSYFMSYVSGAGLSFIRHWVEDPNRIDKVDLIRHFN
    Newman          KLYDLIMCHLQRYKNENDQINGIPFSYFMSYVSGAGLSFIRHWVEDPNRIDKVDLIRHFN
    USA300_FPR3757  KLYDLIMCHLQRYKNENDQINGIPFSYFMSYVSGAGLSFIRHWVEDPNRIDKVDLIRHFN
                    **************************************:***************** ***

    COL             TIVNQGPATIIKNIQ
    N315            TIVNQGPATIIKNIQ
    NCTC8325        TIVNQGPATIIKNIQ
    Newman          TIVNQGPATIIKNIQ
    USA300_FPR3757  TIVNQGPATIIKNIQ
                    ***************