From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006281000
  • symbol?: panD
  • description?: aspartate alpha-decarboxylase

      descriptions from strain specific annotations:

    • aspartate alpha-decarboxylase
    • aspartate 1-decarboxylase
    • Aspartate 1-decarboxylase alpha chain
    • low molecular weight phosphotyrosine protein phosphatase
  • strand?: -
  • coordinates?: 6328474..6340539
  • synteny block?: BlockID0050040
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2613 (panD)
    N315:
    SA2390 (panD)
    NCTC8325:
    Newman:
    NWMN_2494 (panD)
    USA300_FPR3757:
    04-02981:
    SA2981_2535 (panD)
    08BA02176:
    C248_2656 (panD)
    11819-97:
    MS7_2602 (panD)
    71193:
    ST398NM01_2645
    ECT-R 2:
    ECTR2_2451 (panD)
    ED133:
    SAOV_2641c
    ED98:
    SAAV_2663 (panD)
    HO 5096 0412:
    SAEMRSA15_25000 (panD)
    JH1:
    SaurJH1_2673
    JH9:
    SaurJH9_2619
    JKD6008:
    SAA6008_02654 (panD)
    JKD6159:
    SAA6159_02493 (panD)
    LGA251:
    SARLGA251_23700 (panD)
    M013:
    M013TW_2574
    MRSA252:
    SAR2675 (panD)
    MSHR1132:
    SAMSHR1132_24120
    MSSA476:
    SAS2482
    Mu3:
    SAHV_2581 (panD)
    Mu50:
    SAV2597 (panD)
    MW2:
    MW2516 (panD)
    RF122:
    SAB2470c (panD)
    ST398:
    SAPIG2645 (panD)
    T0131:
    SAT0131_02829 (sbcD)
    TCH60:
    HMPREF0772_10595 (panD)
    TW20:
    SATW20_27360 (panD)
    USA300_TCH1516:
    USA300HOU_2591 (panD)
    VC40:
    SAVC_11855

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVI
    N315            ----MMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVI
    NCTC8325        ----MMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVI
    Newman          MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVI
    USA300_FPR3757  ----MMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVI
                        ********************************************************

    COL             AGERGSGKICLNGAASRLVEVGDVVIIMTYAQLNEEEIKNHAPKVAVMNEDNVIIEMIHE
    N315            AGERGSGKICLNGAASRLVEVGDVVIIMTYAQLNEEEIKNHAPKVAVMNEDNVIIEMIHE
    NCTC8325        AGERGSGKICLNGAASRLVEVGDVVIIMTYAQLNEEEIKNHAPKVAVMNEDNVIIEMIHE
    Newman          AGERGSGKICLNGAASRLVEVGDVVIIMTYAQLNEEEIKNHAPKVAVMNEDNVIIEMIHE
    USA300_FPR3757  AGERGSGKICLNGAASRLVEVGDVVIIMTYAQLNEEEIKNHAPKVAVMNEDNVIIEMIHE
                    ************************************************************

    COL             KENTIVL
    N315            KENTIVL
    NCTC8325        KENTIVL
    Newman          KENTIVL
    USA300_FPR3757  KENTIVL
                    *******