From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006303000
  • symbol?:
  • description?: membrane protein
  • strand?: +
  • coordinates?: 6349754..6350179
  • synteny block?: BlockID0050190
  • occurrence?: in 91% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2543
    08BA02176:
    C248_2664
    11819-97:
    MS7_2610
    71193:
    ST398NM01_2653
    ECT-R 2:
    ECTR2_2459
    ED133:
    SAOV_2649
    ED98:
    SAAV_2671
    HO 5096 0412:
    SAEMRSA15_25090
    JH1:
    SaurJH1_2681
    JH9:
    SaurJH9_2627
    JKD6008:
    JKD6159:
    SAA6159_02501
    LGA251:
    SARLGA251_23780
    M013:
    M013TW_2583
    MRSA252:
    SAR2683
    MSHR1132:
    SAMSHR1132_24200
    MSSA476:
    SAS2490
    Mu3:
    SAHV_2589
    Mu50:
    SAV2605
    MW2:
    MW2524
    RF122:
    SAB2478
    ST398:
    SAPIG2653
    T0131:
    SAT0131_02837
    TCH60:
    HMPREF0772_10587
    TW20:
    SATW20_27440
    USA300_TCH1516:
    USA300HOU_2598
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRLKVLFHFIAAIFISFMLLWMTMLFDLISNQSHLKALLLNLDFLIPSDNTPYILEIICH
    N315            MRLKVLFHFIAAIFISFMLLWMTMLFDLISNQSHLKALLLNLDFLIPSDNTPYILEIICH
    NCTC8325        MRLKVLFHFIAAIFISFMLLWMTMLFDLISNQSHLKALLLNLDFLIPSDNTPYILEIICH
    Newman          MRLKVLFHFIAAIFISFMLLWMTMLFDLISNQSHLKALLLNLDFLIPSDNTPYILEIICH
                    ************************************************************

    COL             LLIGSVIYFVFVLLFHTSKRLYYLCYIPLFFLFIALYPFLVFIAQRPIFQFSVTELIGWI
    N315            LLIGSVIYFVFVLLFHTSKRLYYLCYIPLFFLFIALYPFLVFIAQRPIFQFSVTELIGWI
    NCTC8325        LLIGSVIYFVFVLLFHTSKRLYYLCYIPLFFLFIALYPFLVFIAQRPIFQFSVTELIGWI
    Newman          LLIGSVIYFVFVLLFHTSKRLYYLCYIPLFFLFIALYPFLVFIAQRPIFQFSVTELIGWI
                    ************************************************************

    COL             ITHIFFMSLMALVIPRIK
    N315            ITHIFFMSLMALVIPRIK
    NCTC8325        ITHIFFMSLMALVIPRIK
    Newman          ITHIFFMSLMALVIPRIK
                    ******************