From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006310000
  • symbol?:
  • description?: antibiotic biosynthesis monooxygenase

      descriptions from strain specific annotations:

    • antibiotic biosynthesis monooxygenase
    • antibiotic biosynthesis monooxygenase family protein
    • antibiotic biosynthesis monooxygenase subfamily protein
    • Signal transduction protein TRAP
  • strand?: -
  • coordinates?: 6355370..6355813
  • synteny block?: BlockID0050260
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2548
    08BA02176:
    C248_2668
    11819-97:
    MS7_2614
    71193:
    ST398NM01_2657
    ECT-R 2:
    ECTR2_2463
    ED133:
    SAOV_2654c
    ED98:
    SAAV_2676
    HO 5096 0412:
    SAEMRSA15_25140
    JH1:
    SaurJH1_2686
    JH9:
    SaurJH9_2632
    JKD6008:
    SAA6008_02667
    JKD6159:
    SAA6159_02506
    LGA251:
    SARLGA251_23820
    M013:
    M013TW_2587
    MRSA252:
    SAR2688
    MSHR1132:
    SAMSHR1132_24250
    MSSA476:
    SAS2495
    Mu3:
    SAHV_2594
    Mu50:
    SAV2610
    MW2:
    MW2529
    RF122:
    SAB2483c
    ST398:
    SAPIG2657
    T0131:
    SAT0131_02843 (parE)
    TCH60:
    HMPREF0772_10582
    TW20:
    SATW20_27480
    USA300_TCH1516:
    USA300HOU_2603
    VC40:
    SAVC_11910

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIYDEYRSYVIEELDDCLTIQKNNDTAYYDVLEAINDLSNDSLCVLNHLYINEGQEETF
    N315            MNIYDEYRSYLIEELDDCLTIQKNNDTAYYDVLEAINDLSNDSLCVLNHLYINEGQEETF
    NCTC8325        MKIYDEYRSYVIEELDDCLTIQKNNDTAYYDVLEAINDLSNDSLCVLNHLYINEGQEETF
    Newman          MKIYDEYRSYVIEELDDCLTIQKNNDTAYYDVLEAINDLSNDSLCVLNHLYINEGQEETF
    USA300_FPR3757  MKIYDEYRSYVIEELDDCLTIQKNNDTAYYDVLEAINDLSNDSLCVLNHLYINEGQEETF
                    *:********:*************************************************

    COL             EQKFLRRNKHLKNVDGFKALRFLRPRTAGRHYIIITLWENRQAFYHWQNSAEYKHTHKHR
    N315            EQKFLQRNKHLKNVDGFKALRFLRPRTAGRHYIIITLWENRQAFYHWQNSAEYKHTHKHR
    NCTC8325        EQKFLRRNKHLKNVDGFKALRFLRPRTAGRHYIIITLWENRQAFYHWQNSAEYKHTHKHR
    Newman          EQKFLRRNKHLKNVDGFKALRFLRPRTAGRHYIIITLWENRQAFYHWQNSAEYKHTHKHR
    USA300_FPR3757  EQKFLRRNKHLKNVDGFKALRFLRPRTAGRHYIIITLWENRQAFYHWQNSAEYKHTHKHR
                    *****:******************************************************

    COL             GTSKGADVKIINRELSYNIRIELADMV
    N315            GTSKGADVKIINRELSYNIRIELADMV
    NCTC8325        GTSKGADVKIINRELSYNIRIELADMV
    Newman          GTSKGADVKIINRELSYNIRIELADMV
    USA300_FPR3757  GTSKGADVKIINRELSYNIRIELADMV
                    ***************************