From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006312000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 6356163..6356375
  • synteny block?: BlockID0050280
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2549
    08BA02176:
    C248_2670
    11819-97:
    MS7_2615
    71193:
    ST398NM01_2658
    ECT-R 2:
    ECTR2_2464
    ED133:
    SAOV_2656c
    ED98:
    SAAV_2677
    HO 5096 0412:
    SAEMRSA15_25150
    JH1:
    SaurJH1_2687
    JH9:
    SaurJH9_2633
    JKD6008:
    SAA6008_02668
    JKD6159:
    SAA6159_02507
    LGA251:
    SARLGA251_23830
    M013:
    M013TW_2588
    MRSA252:
    SAR2689
    MSHR1132:
    SAMSHR1132_24260
    MSSA476:
    SAS2496
    Mu3:
    SAHV_2595
    Mu50:
    SAV2611
    MW2:
    MW2530
    RF122:
    SAB2485c
    ST398:
    SAPIG2658
    T0131:
    SAT0131_02844
    TCH60:
    HMPREF0772_10580
    TW20:
    SATW20_27490
    USA300_TCH1516:
    USA300HOU_2604
    VC40:
    SAVC_11915

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSFYEYIQTFKDDKTPLGELAIWIKEDDSFPKQEKLTENILSYFHQMSNIDHEFLEIVKR
    N315            MSFYEYIQTFKDDKTPLGELAIWIKEDDSFPKQEKLTENILSYFHQMSNIDHEFLEIVKR
    NCTC8325        MSFYEYIQTFKDDKTPLGELAIWIKEDDSFPKQEKLTENILSYFHQMSNIDHEFLEIVKR
    Newman          MSFYEYIQTFKDDKTPLGELAIWIKEDDSFPKQEKLTENILSYFHQMSNIDHEFLEIVKR
    USA300_FPR3757  MSFYEYIQTFKDDKTPLGELAIWIKEDDSFPKQEKLTENILSYFHQMSNIDHEFLEIVKR
                    ************************************************************

    COL             SLSLYDQLKS
    N315            SLSLYDQLKS
    NCTC8325        SLSLYDQLKS
    Newman          SLSLYDQLKS
    USA300_FPR3757  SLSLYDQLKS
                    **********