From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006316000
  • symbol?:
  • description?: GbsR/MarR family transcriptional regulator

      descriptions from strain specific annotations:

    • GbsR/MarR family transcriptional regulator
    • ArsR family transcriptional regulator
    • putative regulatory protein
    • putative transcriptional regulator
    • transcriptional regulator-like protein
  • strand?: +
  • coordinates?: 6360354..6360954
  • synteny block?: BlockID0050320
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2552
    08BA02176:
    C248_2674
    11819-97:
    MS7_2618 (cudC)
    71193:
    ST398NM01_2661
    ECT-R 2:
    ECTR2_2467
    ED133:
    SAOV_2659
    ED98:
    SAAV_2680
    HO 5096 0412:
    SAEMRSA15_25180
    JH1:
    SaurJH1_2690
    JH9:
    SaurJH9_2636
    JKD6008:
    SAA6008_02671
    JKD6159:
    SAA6159_02510
    LGA251:
    SARLGA251_23860
    M013:
    M013TW_2591
    MRSA252:
    SAR2692
    MSHR1132:
    SAMSHR1132_24290
    MSSA476:
    SAS2499
    Mu3:
    SAHV_2598
    Mu50:
    SAV2614
    MW2:
    MW2533
    RF122:
    SAB2488
    ST398:
    SAPIG2661
    T0131:
    SAT0131_02847
    TCH60:
    HMPREF0772_10577
    TW20:
    SATW20_27520
    USA300_TCH1516:
    USA300HOU_2608
    VC40:
    SAVC_11930

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MTRSQNKQQQLEQAKDIVINSIGQTMDLYGTNRSVGNLYGTMVFEGSMTLDEMRHQLQM
    N315            MMTRSQNKQQQLEQAKDIVINSIGQTMDLYGTNRSVGNLYGTMVFEGSMTLDEMRHQLQM
    NCTC8325        -MTRSQNKQQQLEQAKDIVINSIGQTMDLYGTNRSVGNLYGTMVFEGSMTLDEMRHQLQM
    Newman          -MTRSQNKQQQLEQAKDIVINSIGQTMDLYGTNRSVGNLYGTMVFEGSMTLDEMRHQLQM
    USA300_FPR3757  -MTRSQNKQQQLEQAKDIVINSIGQTMDLYGTNRSVGNLYGTMVFEGSMTLDEMRHQLQM
                     ***********************************************************

    COL             SKPSMSAGVKKLQEFDIVKQQFTRGSRKQHFIAEKDFFIFFRNFFTKKFQREIDINVEAV
    N315            SKPSMSAGVKKLQEFDIVKQQFTRGSRKQHFIAEKDFFIFFRNFFTKKFQREIDINVEAV
    NCTC8325        SKPSMSAGVKKLQEFDIVKQQFTRGSRKQHFIAEKDFFIFFRNFFTKKFQREIDINVEAV
    Newman          SKPSMSAGVKKLQEFDIVKQQFTRGSRKQHFIAEKDFFIFFRNFFTKKFQREIDINVEAV
    USA300_FPR3757  SKPSMSAGVKKLQEFDIVKQQFTRGSRKQHFIAEKDFFIFFRNFFTKKFQREIDINVEAV
                    ************************************************************

    COL             KDAQAIINSLLESSDLTEAETQEAQKIKAQLDHTHVYYEWLEQLTEAIESGEIFKYFPIP
    N315            KDAQAIINPLLESSDLTEAETQEAQKIKAQLDHTHVYYEWLEQLTEAIESGEIFKYFPIP
    NCTC8325        KDAQAIINPLLESSDLTEAETQEAQKIKAQLDHTHVYYEWLEQLTEAIESGEIFKYFPIP
    Newman          KDAQAIINSLLESSDLTEAETQEAQKIKAQLDHTHVYYEWLEQLTEAIESGEIFKYFPIP
    USA300_FPR3757  KDAQAIINSLLESSDLTEAETQEAQKIKSQLDHTHVYYEWLEQLTEAIESGEIFKYFPIP
                    ********.*******************:*******************************

    COL             EQPSDSEN
    N315            EQPSDSEN
    NCTC8325        EQPSDSEN
    Newman          EQPSDSEN
    USA300_FPR3757  EQPSDSEN
                    ********