From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006318000
  • symbol?: cudT
  • description?: choline transporter

      descriptions from strain specific annotations:

    • choline transporter
    • BCCT family osmoprotectant transporter
    • High-affinity choline uptake protein BetT
    • transporter, betaine/carnitine/choline transporter (BCCT) family protein
    • BCCT family choline/carnitine/betaine transporter
    • BCCT family betaine/carnitine/choline transporter
    • transporter, betaine/carnitine/choline transporter family protein
    • choline/carnitine/betaine transporter, BCCT family
    • choline transport protein
    • Choline/carnitine/betaine transporter
  • strand?: -
  • coordinates?: 6362133..6363737
  • synteny block?: BlockID0050340
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2632 (cudT)
    N315:
    SA2408 (cudT)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2553 (betT)
    08BA02176:
    C248_2675 (cudT)
    11819-97:
    MS7_2620
    71193:
    ST398NM01_2662
    ECT-R 2:
    ECTR2_2468
    ED133:
    SAOV_2660c
    ED98:
    SAAV_2681 (cudT)
    HO 5096 0412:
    SAEMRSA15_25190 (cudT)
    JH1:
    SaurJH1_2691
    JH9:
    SaurJH9_2637
    JKD6008:
    SAA6008_02672 (cudT)
    JKD6159:
    SAA6159_02511 (cudT)
    LGA251:
    SARLGA251_23870 (cudT)
    M013:
    M013TW_2592
    MRSA252:
    SAR2693 (cudT)
    MSHR1132:
    SAMSHR1132_24310
    MSSA476:
    SAS2501
    Mu3:
    SAHV_2599 (cudT)
    Mu50:
    SAV2615 (cudT)
    MW2:
    MW2535 (cudT)
    RF122:
    SAB2489c (cudT)
    ST398:
    SAPIG2662
    T0131:
    SAT0131_02848
    TCH60:
    HMPREF0772_10576 (cudT)
    TW20:
    SATW20_27530 (cudT)
    USA300_TCH1516:
    USA300HOU_2610 (betT)
    VC40:
    SAVC_11940

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKEKVMDWTTFIGTVAVLLFAVIPMMAFPKASEDIITGINSAISDSIGSIYLFMGLAIF
    N315            MKKEKVMDWTTFIGTVAVLLFAVIPMMAFPKASEDIITGINSAISDSIGSIYLFMGLAIF
    NCTC8325        MKKEKVMDWTTFIGTVAVLLFAVIPMMAFPKASEDIITGINSAISDSIGSIYLFMGLAIF
    Newman          MKKEKVMDWTTFIGTVAVLLFAVIPMMAFPKASEDIITGINSAISDSIGSIYLFMGLAIF
    USA300_FPR3757  MKKEKVMDWTTFIGTVAVLLFAVIPMMAFPKASEDIITGINSAISDSIGSIYLFMGLAIF
                    ************************************************************

    COL             CFVMYIAFGKYGNVTLGKASDKPEFNTFTWAAMLFCAGIGSDILYWGVIEWAFYYQVPPN
    N315            CFVMYIAFGKYGNVTLGKASDKPEFNTFTWAAMLFCAGIGSDILYWGVIEWAFYYQVPPN
    NCTC8325        CFVMYIAFGKYGNVTLGKASDKPEFNTFTWAAMLFCAGIGSDILYWGVIEWAFYYQVPPN
    Newman          CFVMYIAFGKYGNVTLGKASDKPEFNTFTWAAMLFCAGIGSDILYWGVIEWAFYYQVPPN
    USA300_FPR3757  CFVMYIAFGKYGNVTLGKASDKPEFNTFTWAAMLFCAGIGSDILYWGVIEWAFYYQVPPN
                    ************************************************************

    COL             GAKSMSDEALQYATQYGMFHWGPIAWAIYVLPALPIGYLVFVKKQPVYKISQACRPILKG
    N315            GAKSMSDEALQYATQYGMFHWGPIAWAIYVLPALPIGYLVFVKKQPVYKISQACRPILKG
    NCTC8325        GAKSMSDEALQYATQYGMFHWGPIAWAIYVLPALPIGYLVFVKKQPVYKISQACRPILKG
    Newman          GAKSMSDEALQYATQYGMFHWGPIAWAIYVLPALPIGYLVFVKKQPVYKISQACRPILKG
    USA300_FPR3757  GAKSMSDEALQYATQYGMFHWGPIAWAIYVLPALPIGYLVFVKKQPVYKISQACRPILKG
                    ************************************************************

    COL             QTDKFVGKVVDILFIFGLLGGAATSLALGVPLISAGIERLTGLDGKNMILRSAILLTITV
    N315            QTDKFVGKVVDILFIFGLLGGAATSLALGVPLISAGIERLTGLDGKNMILRSAILLTITV
    NCTC8325        QTDKFVGKVVDILFIFGLLGGAATSLALGVPLISAGIERLTGLDGKNMILRSAILLTITV
    Newman          QTDKFVGKVVDILFIFGLLGGAATSLALGVPLISAGIERLTGLDGKNMILRSAILLTITV
    USA300_FPR3757  QTDKFVGKVVDILFIFGLLGGAATSLALGVPLISAGIERLTGLDGKNMILRSAILLTITV
                    ************************************************************

    COL             IFAISSYTGLKKGIQKLSDINVWLSFVLLAFIFIIGPTVFIMETTVTGFGNMLRDFFHMA
    N315            IFAISSYTGLKKGIQKLSDINVWLSFVLLAFIFIIGPTVFIMETTVTGFGNMLRDFFHMA
    NCTC8325        IFAISSYTGLKKGIQKLSDINVWLSFVLLAFIFIIGPTVFIMETTVTGFGNMLRDFFHMA
    Newman          IFAISSYTGLKKGIQKLSDINVWLSFVLLAFIFIIGPTVFIMETTVTGFGNMLRDFFHMA
    USA300_FPR3757  IFAISSYTGLKKGIQKLSDINVWLSFVLLAFIFIIGPTVFIMETTVTGFGNMLRDFFHMA
                    ************************************************************

    COL             TWLEPFGGIKGRKETNFPQDWTIFYWSWWLVYAPFIGLFIARISKGRRLKEVVLGTIIYG
    N315            TWLEPFGGIKGRKETNFPQDWTIFYWSWWLVYAPFIGLFIARISKGRRLKEVVLGTIIYG
    NCTC8325        TWLEPFGGIKGRKETNFPQDWTIFYWSWWLVYAPFIGLFIARISKGRRLKEVVLGTIIYG
    Newman          TWLEPFGGIKGRKETNFPQDWTIFYWSWWLVYAPFIGLFIARISKGRRLKEVVLGTIIYG
    USA300_FPR3757  TWLEPFGGIKGRKETNFPQDWTIFYWSWWLVYAPFIGLFIARISKGRRLKEVVLGTIIYG
                    ************************************************************

    COL             TLGCVLFFGIFGNYAVYLQISGQFNVTQYLNTHGTEATIIEVVHHLPFPSLMIVLFLVSA
    N315            TLGCVLFFGIFGNYAVYLQISGQFNVTQYLNTHGTEATIIEVVHHLPFPSLMIVLFLVSA
    NCTC8325        TLGCVLFFGIFGNYAVYLQISGQFNVTQYLNTHGTEATIIEVVHHLPFPSLMIVLFLVSA
    Newman          TLGCVLFFGIFGNYAVYLQISGQFNVTQYLNTHGTEATIIEVVHHLPFPSLMIVLFLVSA
    USA300_FPR3757  TLGCVLFFGIFGNYAVYLQISGQFNVTQYLNTHGTEATIIEVVHHLPFPSLMIVLFLVSA
                    ************************************************************

    COL             FLFLATTFDSGSYILAAASQKKVVGEPLRANRLFWAFALCLLPFSLMLVGGERALEVLKT
    N315            FLFLATTFDSGSYILAAASQKKVVGEPLRANRLFWAFALCLLPFSLMLVGGERALEVLKT
    NCTC8325        FLFLATTFDSGSYILAAASQKKVVGEPLRANRLFWAFALCLLPFSLMLVGGERALEVLKT
    Newman          FLFLATTFDSGSYILAAASQKKVVGEPLRANRLFWAFALCLLPFSLMLVGGERALEVLKT
    USA300_FPR3757  FLFLATTFDSGSYILAAASQKKVVGEPLRANRLFWAFALCLLPFSLMLVGGERALEVLKT
                    ************************************************************

    COL             ASILASVPLIVIFIFMMISFLIILGRDRIKLETRAEKLKEVERRSLRIVQVSEEEQDDNL
    N315            ASILASVPLIVIFIFMMISFLIILGRDRIKLETRAEKLKEVERRSLRIVQVSEEEQDDNL
    NCTC8325        ASILASVPLIVIFIFMMISFLIILGRDRIKLETRAEKLKEVERRSLRIVQVSEEEQDDNL
    Newman          ASILASVPLIVIFIFMMISFLIILGRDRIKLETRAEKLKEVERRSLRIVQVSEEEQDDNL
    USA300_FPR3757  ASILASVPLIVIFIFMMISFLIILGRDRIKLETRAEKLKEVERRSLRIVQVSEEEQDDNL
                    ************************************************************