From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006326000
  • symbol?: cysJ
  • description?: assimilatory sulfite reductase (NADPH) flavoprotein subunit

      descriptions from strain specific annotations:

    • assimilatory sulfite reductase (NADPH) flavoprotein subunit
    • sulfite reductase flavoprotein
    • sulfite reductase (NADPH) flavoprotein alpha-component
    • sulfite reductase flavoprotein (NADPH)
    • sulfite reductase (NADPH) flavoprotein subunit alpha
    • putative sulfite reductase [NADPH] flavoprotein alpha-component
    • sulfite reductase (NADPH) alpha subunit
    • sulfite reductase (NADPH) flavoprotein, alpha chain
    • sulfite reductase [NADPH] flavoprotein, alpha-component
    • Sulfite reductase [NADPH] flavoprotein alpha-component
    • sulfite reductase [NADPH] flavoprotein subunit alpha
    • sulfite reductase [NADPH] hemoprotein alpha subunit
    • Sulfite reductase flavo protein alpha-component
  • strand?: -
  • coordinates?: 6369821..6371701
  • synteny block?: BlockID0050420
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2639 (cysJ)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2558
    08BA02176:
    C248_2683 (cysJ)
    11819-97:
    MS7_2625
    71193:
    ST398NM01_2668
    ECT-R 2:
    ECTR2_2474
    ED133:
    SAOV_2666c
    ED98:
    SAAV_2687
    HO 5096 0412:
    SAEMRSA15_25240 (cysJ)
    JH1:
    SaurJH1_2698
    JH9:
    SaurJH9_2643
    JKD6008:
    SAA6008_02678 (cysJ)
    JKD6159:
    SAA6159_02516 (cysJ)
    LGA251:
    SARLGA251_23920 (cysJ)
    M013:
    M013TW_2598
    MRSA252:
    SAR2698 (cysJ)
    MSHR1132:
    SAMSHR1132_24360
    MSSA476:
    SAS2506
    Mu3:
    SAHV_2604
    Mu50:
    SAV2620
    MW2:
    MW2540
    RF122:
    SAB2494c (cysJ)
    ST398:
    SAPIG2668
    T0131:
    SAT0131_02855 (tyrA)
    TCH60:
    HMPREF0772_10570 (cysJ)
    TW20:
    SATW20_27580 (cysJ)
    USA300_TCH1516:
    USA300HOU_2618 (cysJ)
    VC40:
    SAVC_11965

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLNTSNSPFTEKQVTEINNLLQTLTESQQQWLSGFLLANSNDTTSDSNQQQLETEVWQQ
    N315            MKLNTSNSPFTEKQVTEINNLLQTLTESQQQWLSGFLLANSNDTTSDSNQQQLETEVWQQ
    NCTC8325        MKLNTSNSPFTEKQVTEINNLLQTLTESQQQWLSGFLLANSNDTTSDSNQQQLETEVWQQ
    Newman          MKLNTSNSPFTEKQVTEINNLLQTLTESQQQWLSGFLLANSNDTTSDSNQQQLETEVWQQ
    USA300_FPR3757  MKLNTSNSPFTEKQVTEINNLLQTLTESQQQWLSGFLLANSNDTTSDSNQQQLETEVWQQ
                    ************************************************************

    COL             SQISEEQATSTTYMLQNKEPHIEANQRHVTVLYGSESGNAMRLAEIFSERLSDIGHQVVL
    N315            SQISEEQATSTTYMLQNKEPHIEANQRHVTVLYGSESGNAMRLAEIFSERLSDIGHQVVL
    NCTC8325        SQISEEQATSTTYMLQNKEPHIEANQRHVTVLYGSESGNAMRLAEIFSERLSDIGHQVVL
    Newman          SQISEEQATSTTYMLQNKEPHIEANQRHVTVLYGSESGNAMRLAEIFSERLSDIGHQVVL
    USA300_FPR3757  SQISEEQATSTTYMLQNKEPHIEANQRHVTVLYGSESGNAMRLAEIFSERLSDIGHQVVL
                    ************************************************************

    COL             MSMDEYDTTNIAQLEDLFIITSTHGEGEPPDNAWDFFEFLEDDNAPNLNHVRYSVLALGD
    N315            MSMDEYDTTNIAQLEDLFIITSTHGEGEPPDNAWDFFEFLEDDNAPNLNHVRYSVLALGD
    NCTC8325        MSMDEYDTTNIAQLEDLFIITSTHGEGEPPDNAWDFFEFLEDDNAPNLNHVRYSVLALGD
    Newman          MSMDEYDTTNIAQLEDLFIITSTHGEGEPPDNAWDFFEFLEDDNAPNLNHVRYSVLALGD
    USA300_FPR3757  MSMDEYDTTNIAQLEDLFIITSTHGEGEPPDNAWDFFEFLEDDNAPNLNHVRYSVLALGD
                    ************************************************************

    COL             QTYEFFCQAGKDVDVLLENLGAERICKRVDCDIDYEEDAEKWMADIINIIDTTSEGIQSE
    N315            QTYEFFCQAGKDVDALLENLGAERICKRVDCDIDYEEDAEKWMADIINMIDTTSEGIQSE
    NCTC8325        QTYEFFCQAGKDVDVLLENLGAERICKRVDCDIDYEEDAEKWMADIINIIDTTSEGIQSE
    Newman          QTYEFFCQAGKDVDVLLENLGAERICKRVDCDIDYEEDAEKWMADIINIIDTTSEGIQSE
    USA300_FPR3757  QTYEFFCQAGKDVDVLLENLGAERICKRVDCDIDYEEDAEKWMADIINIIDTTSEGIQSE
                    **************.*********************************:***********

    COL             SVISESIKSAKEKKYSKSNPYQAEVLANINLNGTDSNKETRHIEFLLDDFSESYEPGDCI
    N315            SVISESIKSAKEKKYSKLNPYQAEVLANINLNGTDSNKETRHIEFLLDDFSESYEPGDCI
    NCTC8325        SVISESIKSAKEKKYSKSNPYQAEVLANINLNGTDSNKETRHIEFLLDDFSESYEPGDCI
    Newman          SVISESIKSAKEKKYSKSNPYQAEVLANINLNGTDSNKETRHIEFLLDDFSESYEPGDCI
    USA300_FPR3757  SVISESIKSAKEKKYSKSNPYQAEVLANINLNGTDSNKETRHIEFLLDDFSESYEPGDCI
                    ***************** ******************************************

    COL             VALPQNDPELVEKLIFMLGWDPQSPVPINDHGDTVPIVEALTSHFEFTKLTLPLLKNADI
    N315            VALPQNDPELVEKLISMLGWDPQSPVPINDRGDTVPIVEALTSHFEFTKLTLPLLKNADI
    NCTC8325        VALPQNDPELVEKLISMLGWDPQSPVPINDHGDTVPIVEALTSHFEFTKLTLPLLKNADI
    Newman          VALPQNDPELVEKLIFMLGWDPQSPVPINDHGDTVPIVEALTSHFEFTKLTLPLLKNADI
    USA300_FPR3757  VALPQNDPELVEKLIFMLGWDPQSPVPINDHGDTVPIVEALTSHFEFTKLTLPLLKNADI
                    *************** **************:*****************************

    COL             YFDNEELSERIQDESWAREYVINRDFIDLITDFPTIELQPENMYQILRKLPPREYSISSS
    N315            YFDNEELSERIQDESWAREYVINRDFIDLITDFPTIELQPENMYQILRKLPPREYSISSS
    NCTC8325        YFDNEELSERIQDESWAREYVINRDFIDLITDFPTIELQPENMYQILRKLPPREYSISSS
    Newman          YFDNEELSERIQDESWAREYVINRDFIDLITDFPTIELQPENMYQILRKLPPREYSISSS
    USA300_FPR3757  YFDNEELSERIQDESWAREYVINRDFIDLITDFPTIELQPENMYQILRKLPPREYSISSS
                    ************************************************************

    COL             FMATPDEVHITVGTVRYQAHGRERKGVCSVHFAERIKPGDIVPIYLKKNPNFKFPMKQDI
    N315            FMATPDEVHITVGTVRYQAHGRERKGVCSVHFAERIKPGDIVPIYLKKNPNFKFPMKQDI
    NCTC8325        FMATPDEVHITVGTVRYQAHGRERKGVCSVHFAERIKPGDIVPIYLKKNPNFKFPMKQDI
    Newman          FMATPDEVHITVGTVRYQAHGRERKGVCSVHFAERIKPGDIVPIYLKKNPNFKFPMKQDI
    USA300_FPR3757  FMATPDEVHITVGTVRYQAHGRERKGVCSVHFAERIKPGDIVPIYLKKNPNFKFPMKQDI
                    ************************************************************

    COL             PVIMIGPGTGIAPFRAYLQEREELGMTGKTWLFFGDQHRSSDFLYEEEIEEWLENGNLTR
    N315            PVIMIGPGTGIAPFRAYLQEREELGMTGKTWLFFGDQHRSSDFLYEEEIEEWLENGNLTR
    NCTC8325        PVIMIGPGTGIAPFRAYLQEREELGMTGKTWLFFGDQHRSSDFLYEEEIEEWLENGNLTR
    Newman          PVIMIGPGTGIAPFRAYLQEREELGMTGKTWLFFGDQHRSSDFLYEEEIEEWLENGNLTR
    USA300_FPR3757  PVIMIGPGTGIAPFRAYLQEREELGMTGKTWLFFGDQHRSSDFLYEEEIEEWLENGNLTR
                    ************************************************************

    COL             VDLAFSRDQEHKEYVQHRIMEESKRFNEWIEQGAAIYICGDEKCMAKDVHQAIKDVLVKE
    N315            VDLAFSRDQEHKEYVQHRIMEESERFNEWIEQGAAIYICGDEKCMAKDVHQAIKDVLVKE
    NCTC8325        VDLAFSRDQEHKEYVQHRIMEESKRFNEWIEQGAAIYICGDEKCMAKDVHQAIKDVLVKE
    Newman          VDLAFSRDQEHKEYVQHRIMEESKRFNEWIEQGAAIYICGDEKCMAKDVHQAIKDVLVKE
    USA300_FPR3757  VDLAFSRDQEHKEYVQHRIMEESKRFNEWIEQGAAIYICGDEKCMAKDVHQAIKDVLVKE
                    ***********************:************************************

    COL             RHISQEEAELLLRQMKQQQRYQRDVY
    N315            RHISQEEAELLLRQMKQQQRYQRDVY
    NCTC8325        RHISQEEAELLLRQMKQQQRYQRDVY
    Newman          RHISQEEAELLLRQMKQQQRYQRDVY
    USA300_FPR3757  RHISQEEAELLLRQMKQQQRYQRDVY
                    **************************