From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006336000
  • symbol?:
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • ABC transporter protein
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter, ATP-binding protein
    • ABC transporter family protein
    • ATP-binding ABC transporter
    • bacitracin export ATP-binding protein BceA
  • strand?: -
  • coordinates?: 6377420..6378198
  • synteny block?: BlockID0050520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2562
    08BA02176:
    C248_2690
    11819-97:
    MS7_2628
    71193:
    ST398NM01_2672
    ECT-R 2:
    ECTR2_2477
    ED133:
    SAOV_2671c
    ED98:
    SAAV_2691
    HO 5096 0412:
    SAEMRSA15_25270
    JH1:
    SaurJH1_2702
    JH9:
    SaurJH9_2646
    JKD6008:
    SAA6008_02682
    JKD6159:
    SAA6159_02519
    LGA251:
    SARLGA251_23950
    M013:
    M013TW_2602
    MRSA252:
    SAR2701
    MSHR1132:
    SAMSHR1132_24390
    MSSA476:
    SAS2509
    Mu3:
    SAHV_2607
    Mu50:
    SAV2623
    MW2:
    MW2543
    RF122:
    SAB2498c
    ST398:
    SAPIG2672
    T0131:
    SAT0131_02886
    TCH60:
    HMPREF0772_10566
    TW20:
    SATW20_27610
    USA300_TCH1516:
    USA300HOU_2622
    VC40:
    SAVC_11985

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHAMLLEVKHVKKVYGKGLNATTALNQMNLSVGAGEFVAIMGESGSGKSTLLNLIASFDG
    N315            ---MLLEVKHVKKVYGKGLNATTALNQMNLSVGAGEFVAIMGESGSGKSTLLNLIASFDG
    NCTC8325        ---MLLEVKHVKKVYGKGLNATTALNQMNLSVGAGEFVAIMGESGSGKSTLLNLIASFDG
    Newman          ---MLLEVKHVKKVYGKGLNATTALNQMNLSVGAGEFVAIMGESGSGKSTLLNLIASFDG
    USA300_FPR3757  ---MLLEVKHVKKVYGKGLNATTALNQMNLSVGAGEFVAIMGESGSGKSTLLNLIASFDG
                       *********************************************************

    COL             LTEGDIIVDGAHLNNMKNKSKALYRQQMVGFVFQDFNLLPTMTNKENIMMPLILAGAKRK
    N315            LTEGDIIVDGAHLNNMKNKSKALYRQQMVGFVFQDFNLLPTMTNKENIMMPLILAGAKRK
    NCTC8325        LTEGDIIVDGAHLNNMKNKSKALYRQQMVGFVFQDFNLLPTMTNKENIMMPLILAGAKRK
    Newman          LTEGDIIVDGAHLNNMKNKSKALYRQQMVGFVFQDFNLLPTMTNKENIMMPLILAGAKRK
    USA300_FPR3757  LTEGDIIVDGAHLNNMKNKSKALYRQQMVGFVFQDFNLLPTMTNKENIMMPLILAGAKRK
                    ************************************************************

    COL             DIEQRVHQLAVQLHLEGFLNKYPSEISGGQKQRIAIARALVTKPTILLADEPTGALDSKT
    N315            DIEQRVHQLAVQLHLEGFLNKYPSEISGGQKQRIAIARALVTKPTILLADEPTGALDSKT
    NCTC8325        DIEQRVHQLAVQLHLEGFLNKYPSEISGGQKQRIAIARALVTKPTILLADEPTGALDSKT
    Newman          DIEQRVHQLAVQLHLEGFLNKYPSEISGGQKQRIAIARALVTKPTILLADEPTGALDSKT
    USA300_FPR3757  DIEQRVHQLAVQLHLEGFLNKYPSEISGGQKQRIAIARALVTKPTILLADEPTGALDSKT
                    ************************************************************

    COL             SKALMMLFQEIHQLEQTILMVTHSNIDASYAERVIFIKDGRLYHEIYRGEESQLAFQQRI
    N315            SKALMMLFQEIHQLEQTILMVTHSNIDASYAERVIFIKDGRLYHEIYRGEESQLAFQQRI
    NCTC8325        SKALMMLFQEIHQLEQTILMVTHSNIDASYAERVIFIKDGRLYHEIYRGEESQLAFQQRI
    Newman          SKALMMLFQEIHQLEQTILMVTHSNIDASYAERVIFIKDGRLYHEIYRGEESQLAFQQRI
    USA300_FPR3757  SKALMMLFQEIHQLEQTILMVTHSNIDASYAERVIFIKDGRLYHEIYRGEESQLAFQQRI
                    ************************************************************

    COL             TDSLALVNGGSVNI
    N315            TDSLALVNGGSVNI
    NCTC8325        TDSLALVNGGSVNI
    Newman          TDSLALVNGGSVNI
    USA300_FPR3757  TDSLALVNGGSVNI
                    **************