From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN006351000
  • symbol?:
  • description?: DUF2648 domain-containing protein
  • strand?: -
  • coordinates?: 6388505..6388606
  • synteny block?: BlockID0050610
  • occurrence?: in 44% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    71193:
    ST398NM01_3019
    ECT-R 2:
    ED133:
    SAOV_2676c
    ED98:
    SAAV_2696
    HO 5096 0412:
    SAEMRSA15_25320
    JH1:
    SaurJH1_2707
    JH9:
    SaurJH9_2651
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR2706a
    MSHR1132:
    SAMSHR1132_24510
    MSSA476:
    SAS2513a
    Mu3:
    Mu50:
    MW2:
    MW2548
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_2627
    VC40:
    SAVC_12015

Genome Viewer[edit source | edit]

COL chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKLAVILTLVGGLYFAFKKYQERVNQAPNIEY
    USA300_FPR3757  MKKLAVILTLVGGLYFAFKKYQERVNQAPNIEY
                    *********************************