From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006370000
  • symbol?:
  • description?: conserved low-complexity protein

      descriptions from strain specific annotations:

    • conserved low-complexity protein
    • exported protein
    • pseudogene
  • strand?: +
  • coordinates?: 6405623..6406126
  • synteny block?: BlockID0050790
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2578
    08BA02176:
    C248_2707
    11819-97:
    MS7_2644
    71193:
    ST398NM01_2689
    ECT-R 2:
    ECTR2_2493
    ED133:
    SAOV_2688
    ED98:
    SAAV_2709
    HO 5096 0412:
    SAEMRSA15_25440
    JH1:
    SaurJH1_2719
    JH9:
    SaurJH9_2663
    JKD6008:
    SAA6008_02698
    JKD6159:
    SAA6159_02535
    LGA251:
    SARLGA251_24110
    M013:
    M013TW_2620
    MRSA252:
    SAR2718
    MSHR1132:
    SAMSHR1132_24630
    MSSA476:
    SAS2525
    Mu3:
    SAHV_2623
    Mu50:
    SAV2639
    MW2:
    MW2560
    RF122:
    SAB2514
    ST398:
    SAPIG2689
    T0131:
    SAT0131_02905 (pcp)
    TCH60:
    HMPREF0772_10548
    TW20:
    SATW20_27770
    USA300_TCH1516:
    USA300HOU_2639
    VC40:
    SAVC_12075

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKLLITIVIIVLIGALGFAIYAAINHSTSSSNNQEQENKSTHKKTETEENDQQDDSADK
    N315            MKKLLITIVIIVLIGALGFAIYAAINHSTSSSNNQEQENKSTHKKTETEENDQQDDSADK
    NCTC8325        MKKLLITIVIIVLIGALGFAIYAAINHSTSSSNNQEQENKSTHKKTETEENDQQDDSADK
    Newman          MKKLLITIVIIVLIGALGFAIYAAINHSTSSSNNQEQENKSTHKKTETEENDQQDDSADK
    USA300_FPR3757  MKKLLITIVIIVLIGALGFAIYAAINHSTSSSNNQEQENKSTHKKTETEENDQQDDSADK
                    ************************************************************

    COL             TDKNQNNGNNVTNDNQPSSPSNVPNNHSTVPSNTQPAQPKDSNSNKNNTHGGGSQSSTNN
    N315            TDKNQNNGNNDTNDNQPSSPSNVPNNHSTVPSNTQPAQPNDSNSNKNNTHGGGSQSSTNN
    NCTC8325        TDKNQNNGNNVTNDNQPSSPSNVPNNHSTVPSNTQPAQPKDSNSNKNNTHGGGSQSSTNN
    Newman          TDKNQNNGNNVTNDNQPSSPSNVPNNHSTVPSNTQPAQPKDSNSNKNNTHGGGSQSSTNN
    USA300_FPR3757  TDKNQNNGNNVTNDNQPSSPSNVPNNHSTVPSNTQPAQPKDSNSNKNNTHGGGSQSSTNN
                    ********** ****************************:********************

    COL             QNNQQQNTPPANKSNNTNTPSKQTPQAQSPKN
    N315            QNNQQQNTPPANKSNNTNTPSKQTPQAQSPKN
    NCTC8325        QNNQQQNTPPANKSNNTNTPSKQTPQAQSPKN
    Newman          QNNQQQNTPPANKSNNTNTPSKQTPQAQSPKN
    USA300_FPR3757  QNNQQQNTPPANKSNNTNTPSKQTPQAQSPKN
                    ********************************