From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006378000
  • symbol?:
  • description?: isochorismatase hydrolase

      descriptions from strain specific annotations:

    • isochorismatase hydrolase
    • isochorismatase family protein
    • Isochorismatase
    • isochorismatase transposase
    • N-carbamoylsarcosine amidase
  • strand?: -
  • coordinates?: 6418844..6419407
  • synteny block?: BlockID0050860
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2584
    08BA02176:
    C248_2713
    11819-97:
    MS7_2650
    71193:
    ST398NM01_2695
    ECT-R 2:
    ECTR2_2499
    ED133:
    SAOV_2696c
    ED98:
    SAAV_2715
    HO 5096 0412:
    SAEMRSA15_25500
    JH1:
    SaurJH1_2725
    JH9:
    SaurJH9_2669
    JKD6008:
    SAA6008_02704
    JKD6159:
    SAA6159_02541
    LGA251:
    SARLGA251_24170
    M013:
    M013TW_2626
    MRSA252:
    SAR2724
    MSHR1132:
    SAMSHR1132_24690
    MSSA476:
    SAS2531
    Mu3:
    SAHV_2629
    Mu50:
    SAV2645
    MW2:
    MW2566
    RF122:
    SAB2520c
    ST398:
    SAPIG2695
    T0131:
    SAT0131_02913
    TCH60:
    HMPREF0772_10542 (entB2)
    TW20:
    SATW20_27830
    USA300_TCH1516:
    USA300HOU_2645
    VC40:
    SAVC_12105

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSRKTALLVLDMQEGIASSVPRIKNIIKANQRAIEAARQHRIPVIFIRLVLDKHFNDVSS
    N315            MSRKTALLVLDMQEGIASSVPRIKNIIKANQRAIEAARQHRIPVIFIRLVLDKHFNDVSS
    NCTC8325        MSRKTALLVLDMQEGIASSVPRIKNIIKANQRAIEAARQHRIPVIFIRLVLDKHFNDVSS
    Newman          MSRKTALLVLDMQEGIASSVPRIKNIIKANQRAIEAARQHRIPVIFIRLVLDKHFNDVSS
    USA300_FPR3757  MSRKTALLVLDMQEGIASSVPRIKNIIKANQRAIEAARQHRIPVIFIRLVLDKHFNDVSS
                    ************************************************************

    COL             SNKVFSTIKAQGYAITEADASTRILEDLAPLEDEPIISKRRFSAFTGSYLEVYLRANDIN
    N315            SNKVFSTIKAQGYAITEADASTRILEDLAPLEDEPIISKRRFSAFTGSYLEVYLRANDIN
    NCTC8325        SNKVFSTIKAQGYAITEADASTRILEDLAPLEDEPIISKRRFSAFTGSYLEVYLRANDIN
    Newman          SNKVFSTIKAQGYAITEADASTRILEDLAPLEDEPIISKRRFSAFTGSYLEVYLRANDIN
    USA300_FPR3757  SNKVFSTIKAQGYAITEADASTRILEDLAPLEDEPIISKRRFSAFTGSYLEVYLRANDIN
                    ************************************************************

    COL             HLVLTGVSTSGAVLSTALESVDKDYYITVLEDAVGDRSDDKHDFIIEQILSRSCDIESVE
    N315            HLVLTGVSTSGAVLSTALESVDKDYYITVLEDAVGDRSDDKHDFIIEQILSRSCDIESVE
    NCTC8325        HLVLTGVSTSGAVLSTALESVDKDYYITVLEDAVGDRSDDKHDFIIEQILSRSCDIESVE
    Newman          HLVLTGVSTSGAVLSTALESVDKDYYITVLEDAVGDRSDDKHDFIIEQILSRSCDIESVE
    USA300_FPR3757  HLVLTGVSTSGAVLSTALESVDKDYYITVLEDAVGDRSDDKHDFIIEQILSRSCDIESVE
                    ************************************************************

    COL             SWKSSL
    N315            SWKSSL
    NCTC8325        SWKSSL
    Newman          SWKSSL
    USA300_FPR3757  SWKSSL
                    ******