From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006384000
  • symbol?: asp3
  • description?: Accessory secretory protein Asp3

      descriptions from strain specific annotations:

    • Accessory secretory protein Asp3
    • accessory Sec system protein Asp3
    • accessory Sec system asp3
  • strand?: -
  • coordinates?: 6427057..6428016
  • synteny block?: BlockID0050920
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2589 (asp3)
    08BA02176:
    C248_2718
    11819-97:
    MS7_2655 (asp3)
    71193:
    ST398NM01_2700
    ECT-R 2:
    ECTR2_2504
    ED133:
    SAOV_2701c
    ED98:
    SAAV_2720
    HO 5096 0412:
    SAEMRSA15_25550
    JH1:
    SaurJH1_2730
    JH9:
    SaurJH9_2674
    JKD6008:
    SAA6008_02709 (asp3)
    JKD6159:
    SAA6159_02546 (asp3)
    LGA251:
    SARLGA251_24220
    M013:
    M013TW_2631
    MRSA252:
    SAR2729
    MSHR1132:
    SAMSHR1132_24740
    MSSA476:
    SAS2536
    Mu3:
    SAHV_2634
    Mu50:
    SAV2650
    MW2:
    MW2571
    RF122:
    SAB2525c
    ST398:
    SAPIG2700
    T0131:
    SAT0131_02919
    TCH60:
    HMPREF0772_10537 (asp3)
    TW20:
    SATW20_27880
    USA300_TCH1516:
    USA300HOU_2650
    VC40:
    SAVC_12130

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------------------------MLKNKTFKVTWNYISQTTFMYGSKVSFSNGEVT
    N315            MMIHLPLQVGLLIFTTLFWKTSLGEFNMLKNKTFKVTWNYISQTTFMYGSKVSFSNGEVT
    NCTC8325        ---------------------------MLKNKTFKVTWNYISQTTFMYGSKVSFSNGEVT
    Newman          ---------------------------MLKNKTFKVTWNYISQTTFMYGSKVSFSNGEVT
    USA300_FPR3757  ---------------------------MLKNKTFKVTWNYISQTTFMYGSKVSFSNGEVT
                                               *********************************

    COL             FINPLMPSGLPIHEWLMLKQFSKYKSAPSLPILRRGQHYKLHFDFDATPAGSVYFIIIFY
    N315            FINPLMPSGLPIHEWLMLKQFSKYKSAPSLPILRRGQHYKLHFDFDATPAGSVYFIIIFY
    NCTC8325        FINPLMPSGLPIHEWLMLKQFSKYKSAPSLPILRRGQHYKLHFDFDATPAGSVYFIIIFY
    Newman          FINPLMPSGLPIHEWLMLKQFSKYKSAPSLPILRRGQHYKLHFDFDATPAGSVYFIIIFY
    USA300_FPR3757  FINPLMPSGLPIHEWLMLKQFSKYKSAPSLPILRRGQHYKLHFDFDATPAGSVYFIIIFY
                    ************************************************************

    COL             NKNGTKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLIFRCLTITEMTHQYDLEYKS
    N315            NKNGTKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLIFRCLTITEMTHQDDLEYKS
    NCTC8325        NKNGTKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLIFRCLTITEMTHQYDLEYKS
    Newman          NKNGTKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLIFRCLTITEMTHQYDLEYKS
    USA300_FPR3757  NKNGTKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLIFRCLTITEMTHQYDLEYKS
                    ***************************************************** ******

    COL             MRVTKIGDDQYGNDMINVIIAEPSDTYPTISNDFLKLFGHVWLVERWMDDNIEGNIKQLK
    N315            MRVTKIDDNQYGNDRINVIIAEPSDTYPTISNDFLKLFGHVWLVERWMDDDIKENIKQLK
    NCTC8325        MRVTKIGDDQYGNDMINVIIAEPSDTYPTISNDFLKLFGHVWLVERWMDDNIEGNIKQLK
    Newman          MRVTKIGDDQYGNDMINVIIAEPSDTYPTISNDFLKLFGHVWLVERWMDDNIEGNIKQLK
    USA300_FPR3757  MRVTKIGDDQYGNDMINVIIAEPSDTYPTISNDFLKLFGHVWLVERWMDDNIEGNIKQLK
                    ******.*:***** ***********************************:*: ******

    COL             NDLQSQDTLKAINLISYGSKSNVFATYVAQHLGCKVYRTSHEDDDLKGWLTEHVPGNHEL
    N315            DDLQSQDTLTAINLISYGSKSNVFATYVAQHLDCKVYRTSHEDDDLKEWLTEHVPGNNEL
    NCTC8325        NDLQSQDTLKAINLISYGSKSNVFATYVAQHLGCKVYRTSHEDDDLKGWLTEHVPGNHEL
    Newman          NDLQSQDTLKAINLISYGSKSNVFVTYVAQHLGCKVYRTSHEDDDLKGWLTEHVPGNHEL
    USA300_FPR3757  NDLQSQDTLKAINLISYGSKSNVFATYVAQHLGCKVYRTSHEDDDLKGWLTEHVPGNHEL
                    :********.**************.*******.************** *********:**

    COL             KDTNVEVYFKEEQDKHLNYMSRLMNPVRFLDYLDVSKLNGGEVNET
    N315            KDTNVEFYFKEEQDNHLNYMSRLMNPVRFLDYLDVSKLNGGEVNET
    NCTC8325        KDTNVEVYFKEEQDKHLNYMSRLMNPVRFLDYLDVSKLNGGEVNET
    Newman          KDTNVEVYFKEEQDKHLNYMSRLMNPVRFLDYLDVSKLNGGEVNET
    USA300_FPR3757  KDTNVEVYFKEEQDKHLNYMSRLMNPVRFLDYLDVSKLNGGEVNET
                    ******.*******:*******************************