From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006385000
  • symbol?: asp2
  • description?: Accessory secretory protein Asp2

      descriptions from strain specific annotations:

    • Accessory secretory protein Asp2
    • accessory Sec system protein Asp2
    • accessory Sec system asp2
  • strand?: -
  • coordinates?: 6427994..6429562
  • synteny block?: BlockID0050930
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2590 (asp2)
    08BA02176:
    C248_2719
    11819-97:
    MS7_2656 (asp2)
    71193:
    ST398NM01_2701
    ECT-R 2:
    ECTR2_2505
    ED133:
    SAOV_2702c
    ED98:
    SAAV_2721
    HO 5096 0412:
    SAEMRSA15_25560
    JH1:
    SaurJH1_2731
    JH9:
    SaurJH9_2675
    JKD6008:
    SAA6008_02710 (asp2)
    JKD6159:
    SAA6159_02547 (asp2)
    LGA251:
    SARLGA251_24230
    M013:
    M013TW_2632
    MRSA252:
    SAR2730
    MSHR1132:
    SAMSHR1132_24750
    MSSA476:
    SAS2537
    Mu3:
    SAHV_2635
    Mu50:
    SAV2651
    MW2:
    MW2572
    RF122:
    SAB2526c
    ST398:
    SAPIG2701
    T0131:
    SAT0131_02920
    TCH60:
    HMPREF0772_10536 (asp2)
    TW20:
    SATW20_27890
    USA300_TCH1516:
    USA300HOU_2651
    VC40:
    SAVC_12135

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPRKFRVLQIGGDDLEPIFQHKKGVSWDYFDIGLFEFDSGYVEAIEAIVEAEGRFDFIYI
    N315            MPRKFRVLQIGGDDLEPIFQHKKGVSWDYFDIGLFEFDSGYVEAIEAIVEAEGRFDFIYI
    NCTC8325        MPRKFRVLQIGGDDLEPIFQHKKGVSWDYFDIGLFEFDSGYVEAIEAIVEAEGRFDFIYI
    Newman          MPRKFRVLQIGGDDLEPIFQHKKGVSWDYFDIGLFEFDSGYVEAIEAIVEAEGRFDFIYI
    USA300_FPR3757  MPRKFRVLQIGGDDLEPIFQHKKGVSWDYFDIGLFEFDSGYVEAIEAIVEAEGRFDFIYI
                    ************************************************************

    COL             QAPYSETLTNLLQMISEPYNTYVDESFWSVEYEQDENVQKYVVQPLHYRNIEERNNKLEA
    N315            QAPYSETLTNLLQMISEPYNTYVDESFWSVEYEQDENVQKYVVQPLHYRNIEERNNKLEA
    NCTC8325        QAPYSETLTNLLQMISEPYNTYVDESFWSVEYEQDENVQKYVVQPLHYRNIEERNNKLEA
    Newman          QAPYSETLTNLLQMISEPYNTYVDESFWSVEYEQDENVQKYVVQPLHYRNIEERNNKLEA
    USA300_FPR3757  QAPYSETLTNLLQMISEPYNTYVDESFWSVEYEQDENVQKYVVQPLHYRNIEERNNKLEA
                    ************************************************************

    COL             VSFSGQYGDKVSPKLALVHPNFKGDVVYQGNSELTLSGEFRKEFKPIASWQNNLVYDKDK
    N315            VSFSGQYGDKVSPKLALVHPNFKVDVVYQGNSELTLSGEFGKEFKPIASWQNNLVYDKDK
    NCTC8325        VSFSGQYGDKVSPKLALVHPNFKGDVVYQGNSELTLSGEFGKEFKPIASWQNNLVYDKDK
    Newman          VSFSGQYGDKVSPKLALVHPNFKGDVVYQGNSELTLSGEFRKEFKPIASWQNNLVYDKDK
    USA300_FPR3757  VSFSGQYGDKVSPKLALVHPNFKGDVVYQGNSELTLSGEFGKEFKPIASWQNNLVYDKDK
                    *********************** **************** *******************

    COL             VIQIWPEFDIDGAVELQYTFRLIQTGADGALIEQIVLTDDMLDSPLEIPAKPFDAYISVT
    N315            VIQIWPEFDIDGAVELQYTFRLIQTGADGALIEQIILTDDMLDSPLEIPAKPFDAYISVT
    NCTC8325        VIQIWPEFDIDGAVELQYTFRLIQTGADGALIEQIVLTDDMLDSPLEIPAKPFDAYISVT
    Newman          VIQIWPEFDIDGAVELQYTFRLIQTGADGALIEQIVLTDDMLDSPLEIPAKPFDAYISVT
    USA300_FPR3757  VIQIWPEFDIDGAVELQYTFRLIQTGADGALIEQIVLTDDMLDSPLEIPAKPFDAYISVT
                    ***********************************:************************

    COL             VKARGNGTVHLGPIHKRWSRLDMGQFLLGGSRFVDSQRQEFIYYFHPGDMKPPLNVYFSG
    N315            VKARGNGTVHLGPIHKRWSRLDMGQFLLGGSRFVDSQRQEFIYYFHPGDMKPPLNVYFSG
    NCTC8325        VKARGNGTVHLGPIHKRWSRLDMGQFLLGGSRFVDSQRQEFIYYFHPGDMKPPLNVYFSG
    Newman          VKARGNGTVHLGPIHKRWSRLDMGQFLLGGSRFVDSQRQEFIYYFHPGDMKPPLNVYFSG
    USA300_FPR3757  VKARGNGTVHLGPIHKRWSRLDMGQFLLGGSRFVDSQRQEFIYYFHPGDMKPPLNVYFSG
                    ************************************************************

    COL             YRTAEGFEGYYMMKRMNAPFLLIGDPRVEGGSFYIGSSEYEQGIINVIDETLEKLNFKSH
    N315            YRTAEGFEGYYMMKRMNAPFLLIGDPRVEGGSFYIGSSEYEQGIINVIDETLEKLNFKSH
    NCTC8325        YRTAEGFEGYYMMKRMNAPFLLIGDPRVEGGSFYIGSSEYEQGIINVIDETLEKLNFKSH
    Newman          YRTAEGFEGYYMMKRMNAPFLLIGDPRVEGGSFYIGSSEYEQGIINVIDETLEKLNFKSH
    USA300_FPR3757  YRTAEGFEGYYMMKRMNAPFLLIGDPRVEGGSFYIGSSEYEQGIINVIDETLEKLNFKSH
                    ************************************************************

    COL             ELILSGLSMGSFGALYYGAQLNPQAIIVGKPLVNIGTIAEHMRLLRPEEFGTALDVLVSN
    N315            ELILSGLSMGSFGALYYGAQLNPQAIIVGKPLVNIGTIAEHMRLLRPEEFGTALDVLVSN
    NCTC8325        ELILSGLSMGSFGALYYGAQLNPQAIIVGKPLVNIGTIAEHMRLLRPEEFGTALDVLVSN
    Newman          ELILSGLSMGSFGALYYGAQLNPQAIIVGKPLVNIGTIAEHMRLLRPEEFGTALDVLVSN
    USA300_FPR3757  ELILSGLSMGSFGALYYGAQLNPQAIIVGKPLVNIGTIAEHMRLLRPEEFGTALDVLVSN
                    ************************************************************

    COL             EGDTSQASIQALNQKFWQTFQKKSLSQTVFAIAYMQHDDYDPHAFQELLPVLTAHQARVM
    N315            EGDTSQASIKALNQKFWQTFQKKSLSQTVFAIAYMQHDDYDPHAFQELLPVLTAHQARVM
    NCTC8325        EGDTSQASIQALNQKFWQTFQKKSLSQTVFAIAYMQHDDYDPHAFQELLPVLTAHQARVM
    Newman          EGDTSQASIQALNQKFWQTFQKKSLSQTVFAIAYMQHDDYDPHAFQELLPVLTAHQARVM
    USA300_FPR3757  EGDTSQASIQALNQKFWQTFQKKSLSQTVFAIAYMQHDDYDPHAFQELLPVLTAHQARVM
                    *********:**************************************************

    COL             NRSIPGRHNDDSPTIASWFVNFYNIILEDKFGRVQHAEKQNI
    N315            NRSIPGRHNDDSPTIASWFVNFYNIILEDKFGRVQHAEKQNI
    NCTC8325        NRSIPGRHNDDSPTIASWFVNFYNIILEDKFGRVQHAEKQNI
    Newman          NRSIPGRHNDDSPTIASWFVNFYNIILEDKFGRVQHAEKQNI
    USA300_FPR3757  NRSIPGRHNDDSPTIASWFVNFYNIILEDKFGRVQHAEKQNI
                    ******************************************