From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006392000
  • symbol?:
  • description?: flavin reductase-like, FMN-binding

      descriptions from strain specific annotations:

    • flavin reductase-like, FMN-binding
    • flavin reductase like domain protein
    • putative flavin reductase
    • flavin reductase family, FMN-binding protein
    • pseudogene
    • FAD-dependent oxidoreductase
  • strand?: -
  • coordinates?: 6445542..6446433
  • synteny block?: BlockID0050990
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2594
    08BA02176:
    C248_2723
    11819-97:
    MS7_2660
    71193:
    ST398NM01_2705
    ECT-R 2:
    ECTR2_2509
    ED133:
    SAOV_2706c
    ED98:
    SAAV_2727
    HO 5096 0412:
    SAEMRSA15_25610
    JH1:
    SaurJH1_2736
    JH9:
    SaurJH9_2679
    JKD6008:
    SAA6008_02714
    JKD6159:
    SAA6159_02551
    LGA251:
    SARLGA251_24270
    M013:
    M013TW_2636
    MRSA252:
    SAR2735
    MSHR1132:
    SAMSHR1132_24790
    MSSA476:
    SAS2541
    Mu3:
    SAHV_2639
    Mu50:
    SAV2655
    MW2:
    MW2576
    RF122:
    SAB2530c
    ST398:
    SAPIG2705
    T0131:
    SAT0131_02933 (arlS)
    TCH60:
    HMPREF0772_10532
    TW20:
    SATW20_27930
    USA300_TCH1516:
    USA300HOU_2655
    VC40:
    SAVC_12155

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNYSPKQGVRSHGLPHDPFKSSTVPRPIGWISTVSKDGKDNLAPYSQYQNLTWDPPMVMF
    N315            MNYSPKQGVRSHGLPHDPFKSSTVPRPIGWISTVSKDGKDNLAPYSQYQNLTWDPPMVMF
    NCTC8325        MNYSPKQGVRSHGLPHDPFKSSTVPRPIGWISTVSKDGKDNLAPYSQYQNLTWDPPMVMF
    Newman          MNYSPKQGVRSHGLPHDPFKSSTVPRPIGWISTVSKDGKDNLAPYSQYQNLTWDPPMVMF
    USA300_FPR3757  MNYSPKQGVRSHGLPHDPFKSSTVPRPIGWISTVSKDGKDNLAPYSQYQNLTWDPPMVMF
                    ************************************************************

    COL             AANQSVLGDHERKDTVKNAEETGWFVWNMATYDLREAVNLSSKALPPEEDEFNFAGVTKE
    N315            AANQSVLGDHERKDTVKNAEETGWFVWNMATYDLREAVNLSSKALPPEEDEFEYAGVTKE
    NCTC8325        AANQSVLGDHERKDTVKNAEETGWFVWNMATYDLREAVNLSSKALPPEEDEFNFAGVTKE
    Newman          AANQSVLGDHERKDTVKNAEETGWFVWNMATYDLREAVNLSSKALPPEEDEFNFAGVTKE
    USA300_FPR3757  AANQSVLGDHERKDTVKNAEETGWFVWNMATYDLREAVNLSSKALPPEEDEFNFADVTKE
                    ****************************************************::*.****

    COL             KCIEAPGYRVKESPVHFECEYVQTIRIPTGDPVSTVDIVIGRVAQVHIDDKVILDNGKLD
    N315            ACIEAPGYRVKESPVHFECEYVQTIRIPTGDPVSTVDIVIGRVAQVHIDDKVILDNGKLD
    NCTC8325        KCIEAPGYRVKESPVHFECEYVQTIRIPTGDPVSTVDIVIGRVAQVHIDDKVILDNGKLD
    Newman          KCIEAPGYRVKESPVHFECEYVQTIRIPTGDPVSTVDIVIGRVAQVHIDDKVILDNGKLD
    USA300_FPR3757  KCIEAPGYRVKESPVHFECEYVQTIRIPTGDPVSTVDIVIGRVAQVHIDDKVILDNGKLD
                     ***********************************************************

    COL             IKSIKPIARLGYYDYTVVNEIFEMKAPAASKEELAGLEGRNFDNQSDEKI
    N315            IKSIKPIARLGYYDYTVVNEIFEMKAPAASKEELAGLEGRNFDNQSDEKR
    NCTC8325        IKSIKPIARLGYYDYTVVNEIFEMKAPAASKEELAGLEGRNFDNQSDEKI
    Newman          IKSIKPIARLGYYDYTVVNEIFEMKAPAASKEELAGLEGRNFDNQSDEKI
    USA300_FPR3757  IKSIKPIARLGYYDYTVVNEIFEMKAPAASKEELAGLEGRNFDNQSDEKI
                    *************************************************