Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN006399000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 6448898..6451609
  • synteny block?: BlockID0051060
  • occurrence?: in 41% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2595
    08BA02176:
    11819-97:
    MS7_2661
    71193:
    ECT-R 2:
    ECTR2_2510
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    SaurJH1_2737
    JH9:
    SaurJH9_2680
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_2640
    Mu50:
    SAV2656
    MW2:
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_2656
    VC40:
    SAVC_12160

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            ------------------MNFRTDSIDDLDKFKKEFKPVMHLKGDAFNQQLQSLINKYPQ
    NCTC8325        MSEKLQVKQEFNGVTRQYLNFRTDSIDDLDKFKKEFKPVMHLKGDAFNQQLQSLINKYPQ
    Newman          MSEKLQVKQEFNGVTRQYLNFRTDSIDDLDKFKKEFKPVMHLKGDAFNQQLQSLINKYPQ
    USA300_FPR3757  MSEKLQVKQEFNGVTRQYLNFRTDSIDDLDKFKKEFKPVMHLKGDAFNQQLQSLINKYPQ
                                      :*****************************************

    N315            IQKNMKSEFIAYYDKEKNRETVKNYAWNLQKSINDIMQSYPSTKFVQFYKDDVSPSMVDG
    NCTC8325        IQKNMKSEFIAYYDKEKNRETVKNYAWNLQKSINDIMQSYPSTKFVQFYKDDVSPSMVDG
    Newman          IQKNMKSEFIAYYDKEKNRETVKNYAWNLQKSINDIMQSYPSTKFVQFYKDDVSPSMVDG
    USA300_FPR3757  IQKNMKSEFIAYYDKEKNRETVKNYAWNLQKSINDIMQSYPSTKFVQFYKDDVSPSMVDG
                    ************************************************************

    N315            NGRLKSDTNVISIEGGKYDENK
    NCTC8325        NGRLKSDTNVISIEGGKYDENK
    Newman          NGRLKSDTNVISIEGGKYDENK
    USA300_FPR3757  NGRLKSDTNVISIEGGKYDENK
                    **********************