From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006407000
  • symbol?: cap1C
  • description?: capsular polysaccharide synthesis protein CapC

      descriptions from strain specific annotations:

    • capsular polysaccharide synthesis protein CapC
    • capsular polysaccharide biosynthesis protein
    • protein-tyrosine-phosphatase
    • capsular polysaccharide biosynthesis protein Cap1C
    • Manganese-dependent protein-tyrosine phosphatase
    • putative tyrosine-protein phosphatase capC
    • capsular polysaccharide biosynthesis protein, Cap5C
    • capsular polysaccharide biosynthesis protein, CapC
    • capsular polysaccharide biosynthesis protein CapC
    • capsule synthesis protein
    • tyrosine-protein phosphatase YwqE
    • putative capsule synthesis protein
    • phosphotyrosine-protein phosphatase (capsular polysaccharide biosynthesis)
  • strand?: -
  • coordinates?: 6457320..6458087
  • synteny block?: BlockID0051140
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2685 (cap1C)
    N315:
    NCTC8325:
    Newman:
    NWMN_2561 (capC)
    USA300_FPR3757:
    SAUSA300_2596 (cap1C)
    04-02981:
    SA2981_2601 (capC)
    08BA02176:
    C248_2732
    11819-97:
    MS7_2667 (ywqE)
    71193:
    ST398NM01_2714
    ECT-R 2:
    ECTR2_2516
    ED133:
    SAOV_2714c
    ED98:
    SAAV_2734 (cap1C)
    HO 5096 0412:
    SAEMRSA15_25690
    JH1:
    SaurJH1_2743
    JH9:
    SaurJH9_2686
    JKD6008:
    SAA6008_02722 (cap1C)
    JKD6159:
    SAA6159_02558 (cap1C)
    LGA251:
    SARLGA251_24360
    M013:
    M013TW_2645
    MRSA252:
    SAR2743
    MSHR1132:
    SAMSHR1132_24900
    MSSA476:
    SAS2548
    Mu3:
    SAHV_2646
    Mu50:
    SAV2662
    MW2:
    MW2582 (capC)
    RF122:
    SAB2537c
    ST398:
    SAPIG2714
    T0131:
    SAT0131_02941
    TCH60:
    HMPREF0772_10524 (capC)
    TW20:
    SATW20_28000
    USA300_TCH1516:
    USA300HOU_2662 (capC)
    VC40:
    SAVC_12190

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIDIHNHILVDIDDGPKTIEKSIALLKQAKDEGVTSIVATPHHLHPRYDNTFQQVLVKLA
    N315            MIDIHNHILVDIDDGPKTIEKSIALLKQAKDEGVTSIVATPHHLHPRYDNTFQQVLVKLA
    NCTC8325        MIDIHNHILVDIDDGPKTIEKSIALLKQAKDEGVTSIVATPHHLHPRYDNTFQQVLVKLA
    Newman          MIDIHNHILVDIDDGPKTIEKSIALLKQAKDEGVTSIVATPHHLHPRYDNTFQQVLVKLA
    USA300_FPR3757  MIDIHNHILVDIDDGPKTIEKSIALLKQAKDEGVTSIVATPHHLHPRYDNTFQQVLVKLA
                    ************************************************************

    COL             ELRTHPEVQALDIKLFPGQEIRITDSILKGLDNGSIQGINRSKYLLIEFPTGEVPHYTKQ
    N315            ELRTHPEVQALDIKLFPGQEIRITDSILKGLDNGSIQGINRSKYLLIEFPTGEVPHYTKQ
    NCTC8325        ELRTHPEVQALDIKLFPGQEIRITDSILKGLDNGSIQGINRSKYLLIEFPTGEVPHYTKQ
    Newman          ELRTHPEVQALDIKLFPGQEIRITDSILKGLDNGSIQGINRSKYLLIEFPTGEVPHYTKQ
    USA300_FPR3757  ELRTHPEVQALDIKLFPGQEIRITDSILKGLDNGSIQGINRSKYLLIEFPTGEVPHYTKQ
                    ************************************************************

    COL             LFFEIQSRGYIPIIAHPERNRSIAKNPEILYELVANGALSQLTSSSLVGGFGKNIQKLSL
    N315            LFFEIQSRGYIPIIAHPERNRSIAKNPEILYELVANGALSQLTSSSLVGGFGKNIQKLSL
    NCTC8325        LFFEIQSRGYIPIIAHPERNRSIAKNPEILYELVANGALSQLTSSSLVGGFGKNIQKLSL
    Newman          LFFEIQSRGYIPIIAHPERNRSIAKNPEILYELVANGALSQLTSSSLVGGFGKNIQKLSL
    USA300_FPR3757  LFFEIQSRGYIPIIAHPERNRSIAKNPEILYELVANGALSQLTSSSLVGGFGKNIQKLSL
                    ************************************************************

    COL             QFIECNLAHFVASDAHSCDQRPFLMQELFHNHKLKKYSNDIEALLRNASSVINDNFVYLD
    N315            QFIECNLAHFVASDAHSCDQRPFLMQELFHNHKLKKYSNDIEALLRNASSVINDNFVYLD
    NCTC8325        QFIECNLAHFVASDAHSCDQRPFLMQELFHNHKLKKYSNDIEALLRNASSVINDNFVYLD
    Newman          QFIECNLAHFVASDAHSCDQRPFLMQELFHNHKLKKYSNDIEALLRNASSVINDNFVYLD
    USA300_FPR3757  QFIECNLAHFVASDAHSCDQRPFLMQELFHNHKLKKYSNDIEALLRNASSVINDNFVYLD
                    ************************************************************

    COL             RPTKPGKVKSFLKWF
    N315            RPTKPGKVKSFLKWF
    NCTC8325        RPTKPGKVKSFLKWF
    Newman          RPTKPGKVKSFLKWF
    USA300_FPR3757  RPTKPGKVKSFLKWF
                    ***************