From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006408000
  • symbol?: cap1B
  • description?: capsular polysaccharide biosynthesis protein

      descriptions from strain specific annotations:

    • capsular polysaccharide biosynthesis protein
    • exopolysaccharide tyrosine-protein kinase
    • capsular polysaccharide biosynthesis protein Cap1B
    • Tyrosine-protein kinase EpsD
    • putative tyrosine-protein kinase capB
    • capsular polysaccharide synthesis protein CapB
    • capsule synthesis protein
    • tyrosine-protein kinase YwqD
    • capsular polysaccharide biosynthesis protein Cap5B
    • capsular polysaccharide biosynthesis protein CapB
    • putative capsule synthesis protein
    • non-specific protein-tyrosine kinase
    • Tyrosine-protein kinase (capsular polysaccharide biosynthesis)
  • strand?: -
  • coordinates?: 6458084..6458680
  • synteny block?: BlockID0051150
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2686 (cap1B)
    N315:
    NCTC8325:
    Newman:
    NWMN_2562 (capB)
    USA300_FPR3757:
    SAUSA300_2597 (cap1B)
    04-02981:
    SA2981_2602 (epsD)
    08BA02176:
    C248_2733
    11819-97:
    MS7_2668 (ywqD)
    71193:
    ST398NM01_2715
    ECT-R 2:
    ECTR2_2517
    ED133:
    SAOV_2715c
    ED98:
    SAAV_2735 (cap1B)
    HO 5096 0412:
    SAEMRSA15_25700
    JH1:
    SaurJH1_2744
    JH9:
    SaurJH9_2687
    JKD6008:
    SAA6008_02723 (cap1B)
    JKD6159:
    SAA6159_02559 (cap1B)
    LGA251:
    SARLGA251_24370
    M013:
    M013TW_2646
    MRSA252:
    SAR2744
    MSHR1132:
    SAMSHR1132_24910
    MSSA476:
    SAS2549
    Mu3:
    SAHV_2647
    Mu50:
    SAV2663
    MW2:
    MW2583 (capB)
    RF122:
    SAB2538c
    ST398:
    SAPIG2715
    T0131:
    SAT0131_02942 (murG)
    TCH60:
    HMPREF0772_10523 (capB)
    TW20:
    SATW20_28010
    USA300_TCH1516:
    USA300HOU_2663 (capB)
    VC40:
    SAVC_12195

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAA
    N315            MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAA
    NCTC8325        MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAA
    Newman          MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAA
    USA300_FPR3757  MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAA
                    ************************************************************

    COL             NLAVAYAQAGYKTLIVDGDMRKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLD
    N315            NLAVAYAQAGYKTLIVDGDMRKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLD
    NCTC8325        NLAVAYAQAGYKTLIVDGDMRKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLD
    Newman          NLAVAYAQAGYKTLIVDGDMRKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLD
    USA300_FPR3757  NLAVAYAQAGYKTLIVDGDMRKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLD
                    ************************************************************

    COL             VLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPPVNTVTDAQLFSKFTGNVVYV
    N315            VLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPPVNTVTDAQLFSKFTGNVVYV
    NCTC8325        VLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPPVNTVTDAQLFSKFTGNVVYV
    Newman          VLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPPVNTVTDAQLFSKFTGNVVYV
    USA300_FPR3757  VLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPPVNTVTDAQLFSKFTGNVVYV
                    ************************************************************

    COL             VNSENNNRDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
    N315            VNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
    NCTC8325        VNSENNNRDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
    Newman          VNSENNNRDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
    USA300_FPR3757  VNSENNNRDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
                    *******:******************************************