From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006410000
  • symbol?: icaR
  • description?: biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR

      descriptions from strain specific annotations:

    • biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR
    • ica operon transcriptional regulator IcaR
    • intercellular adhesion regulator
    • biofilm synthesis ica operon transcriptional regulator
    • intercellular adhesion operon transcription regulator
    • Biofilm operon icaABCD HTH-type negative transcriptional regulator IcaR
    • biofilm operon icaABCD HTH-type negative transcriptional regulatoricaR (Intercellular adhesion protein R)
    • ica operon HTH-type negative transcriptional regulator
    • ica operon transcriptional regulator R
    • ica operon transcription regulator
    • Intercellular adhesion protein R
    • putative negative transcriptional regulator IcaR
    • TetR family transcriptional regulator
  • strand?: -
  • coordinates?: 6460719..6461279
  • synteny block?: BlockID0051170
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2688 (icaR)
    N315:
    SA2458 (icaR)
    NCTC8325:
    Newman:
    NWMN_2564 (icaR)
    USA300_FPR3757:
    04-02981:
    SA2981_2604 (icaR)
    08BA02176:
    C248_2735 (icaR)
    11819-97:
    MS7_2670 (icaR)
    71193:
    ST398NM01_2717
    ECT-R 2:
    ECTR2_2519
    ED133:
    SAOV_2717c
    ED98:
    SAAV_2737 (icaR)
    HO 5096 0412:
    SAEMRSA15_25720 (icaR)
    JH1:
    SaurJH1_2746
    JH9:
    SaurJH9_2689
    JKD6008:
    SAA6008_02725 (icaR)
    JKD6159:
    SAA6159_02561 (icaR)
    LGA251:
    SARLGA251_24390 (icaR)
    M013:
    M013TW_2648
    MRSA252:
    SAR2746 (icaR)
    MSHR1132:
    SAMSHR1132_24930
    MSSA476:
    SAS2551
    Mu3:
    SAHV_2649 (icaR)
    Mu50:
    SAV2665 (icaR)
    MW2:
    MW2585 (icaR)
    RF122:
    SAB2540c (icaR)
    ST398:
    SAPIG2717
    T0131:
    SAT0131_02944 (ctpA)
    TCH60:
    HMPREF0772_10521 (icaR)
    TW20:
    SATW20_28030 (icaR)
    USA300_TCH1516:
    USA300HOU_2665 (icaR)
    VC40:
    SAVC_12205

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFDYLN
    N315            MKDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFDYLN
    NCTC8325        MKDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFDYLN
    Newman          MKDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFDYLN
    USA300_FPR3757  MKDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFDYLN
                    ************************************************************

    COL             NIIMMNQNKSNYSIDALYQFLFEFIFDIEERYIRMYVQLSNTPEEFSGNIYGQIQDLNQS
    N315            NIIMMNQNKSNYSIDALYQFLFEFIFDIEERYIRMYVQLSNTPEEFSGNIYGQIQDLNQS
    NCTC8325        NIIMMNQNKSNYSIDALYQFLFEFIFDIEERYIRMYVQLSNTPEEFSGNIYGQIQDLNQS
    Newman          NIIMMNQNKSNYSIDALYQFLFEFIFDIEERYIRMYVQLSNTPEEFSGNIYGQIQDLNQS
    USA300_FPR3757  NIIMMNQNKSNYSIDALYQFLFEFIFDIEERYIRMYVQLSNTPEEFSGNIYGQIQDLNQS
                    ************************************************************

    COL             LSKEIAKFYDESKIKMTKEDFQNLILLFLESWYLKASFSQKFGAVEESKSQFKDEVYSLL
    N315            LSKEIAKFYDESKIKMTKEDFQNLILLFLESWYLKASFSQKFGAVEESKSQFKDEVYSLL
    NCTC8325        LSKEIAKFYDESKIKMTKEDFQNLILLFLESWYLKASFSQKFGAVEESKSQFKDEVYSLL
    Newman          LSKEIAKFYDESKIKMTKEDFQNLILLFLESWYLKASFSQKFGAVEESKSQFKDEVYSLL
    USA300_FPR3757  LSKEIAKFYDESKIKMTKEDFQNLILLFLESWYLKASFSQKFGAVEESKSQFKDEVYSLL
                    ************************************************************

    COL             NIFLKK
    N315            NIFLKK
    NCTC8325        NIFLKK
    Newman          NIFLKK
    USA300_FPR3757  NIFLKK
                    ******