From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006431000
  • symbol?: hisB
  • description?: imidazoleglycerol-phosphate dehydratase

      descriptions from strain specific annotations:

    • imidazoleglycerol-phosphate dehydratase
    • imidazoleglycerol-phosphate dehydratase (IGPD)
    • imidazoleglycerol-phosphate dehydratase family protein
    • putative imidazoleglycerol-phosphate dehydratase
    • histidine biosynthesis bifunctional protein HisB (histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase)
  • strand?: -
  • coordinates?: 6473453..6474031
  • synteny block?: BlockID0051380
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2700 (hisB)
    N315:
    SA2468 (hisB)
    NCTC8325:
    Newman:
    NWMN_2574 (hisB)
    USA300_FPR3757:
    04-02981:
    SA2981_2616 (hisB)
    08BA02176:
    C248_2745 (hisB)
    11819-97:
    MS7_2681
    71193:
    ST398NM01_2727
    ECT-R 2:
    ECTR2_2529
    ED133:
    SAOV_2727c
    ED98:
    SAAV_2749 (hisB)
    HO 5096 0412:
    SAEMRSA15_25820 (hisB)
    JH1:
    SaurJH1_2757 (hisB)
    JH9:
    SaurJH9_2700 (hisB)
    JKD6008:
    SAA6008_02735 (hisB)
    JKD6159:
    SAA6159_02573 (hisB)
    LGA251:
    SARLGA251_24490 (hisB)
    M013:
    M013TW_2659
    MRSA252:
    SAR2758 (hisB)
    MSHR1132:
    SAMSHR1132_25030
    MSSA476:
    SAS2561 (hisB)
    Mu3:
    SAHV_2660 (hisB)
    Mu50:
    SAV2676 (hisB)
    MW2:
    MW2595 (hisB)
    RF122:
    SAB2552c (hisB)
    ST398:
    SAPIG2727 (hisB)
    T0131:
    SAT0131_02955 (thyA)
    TCH60:
    HMPREF0772_10510 (hisB)
    TW20:
    SATW20_28130 (hisB)
    USA300_TCH1516:
    USA300HOU_2677 (hisB)
    VC40:
    SAVC_12255 (hisB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIYQKQRNTAETQLNISISDDQSPSHINTGVGFLNHMLTLFTFHSGLSLNIEAQGDIDVD
    N315            MIYQKQRNTAETQLNISISDDQSPSHINTGVGFLNHMLTLFTFHSGLSLNIEAQGDIDVD
    NCTC8325        MIYQKQRNTAETQLNISISDDQSPSHINTGVGFLNHMLTLFTFHSGLSLNIEAQGDIDVD
    Newman          MIYQKQRNTAETQLNISISDDQSPSHINTGVGFLNHMLTLFTFHSGLSLNIEAQGDIDVD
    USA300_FPR3757  MIYQKQRNTAETQLNISISDDQSPSHINTGVGFLNHMLTLFTFHSGLSLNIEAQGDIDVD
                    ************************************************************

    COL             DHHVTEDIGIVIGQLLLEMIKDKKHFVRYGTMYIPMDETLARVVVDISGRPYLSFNASLS
    N315            DHHVTEDIGIVIGQLLLEMIKDKKHFVRYGTMYIPMDETLARVVVDISGRPYLSFNASLS
    NCTC8325        DHHVTEDIGIVIGQLLLEMIKDKKHFVRYGTMYIPMDETLARVVVDISGRPYLSFNASLS
    Newman          DHHVTEDIGIVIGQLLLEMIKDKKHFVRYGTMYIPMDETLARVVVDISGRPYLSFNASLS
    USA300_FPR3757  DHHVTEDIGIVIGQLLLEMIKDKKHFVRYGTMYIPMDETLARVVVDISGRPYLSFNASLS
                    ************************************************************

    COL             KEKVGTFDTELVEEFFRAVVINARLTTHIDLIRGGNTHHEIEAIFKAFSRALGIALTATD
    N315            KEKVGTFDTELVEEFFRAVVINARLTTHIDLIRGGNTHHEIEAIFKAFSRALGIALTATD
    NCTC8325        KEKVGTFDTELVEEFFRAVVINARLTTHIDLIRGGNTHHEIEAIFKAFSRALGIALTATD
    Newman          KEKVGTFDTELVEEFFRAVVINARLTTHIDLIRGGNTHHEIEAIFKAFSRALGIALTATD
    USA300_FPR3757  KEKVGTFDTELVEEFFRAVVINARLTTHIDLIRGGNTHHEIEAIFKAFSRALGIALTATD
                    ************************************************************

    COL             DQRVPSSKGVIE
    N315            DQRVPSSKGVIE
    NCTC8325        DQRVPSSKGVIE
    Newman          DQRVPSSKGVIE
    USA300_FPR3757  DQRVPSSKGVIE
                    ************