From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006434000
  • symbol?: hisG
  • description?: ATP phosphoribosyltransferase

      descriptions from strain specific annotations:

    • ATP phosphoribosyltransferase
    • ATP phosphoribosyltransferase catalytic subunit
    • putative ATP phosphoribosyltransferase
  • strand?: -
  • coordinates?: 6476272..6476886
  • synteny block?: BlockID0051410
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2703 (hisG)
    N315:
    SA2471 (hisG)
    NCTC8325:
    Newman:
    NWMN_2577 (hisG)
    USA300_FPR3757:
    04-02981:
    SA2981_2619 (hisG)
    08BA02176:
    C248_2748 (hisG)
    11819-97:
    MS7_2684 (hisG)
    71193:
    ST398NM01_2730
    ECT-R 2:
    ECTR2_2532 (hisG)
    ED133:
    SAOV_2730c
    ED98:
    SAAV_2753 (hisG)
    HO 5096 0412:
    SAEMRSA15_25850 (hisG)
    JH1:
    SaurJH1_2760 (hisG)
    JH9:
    SaurJH9_2703 (hisG)
    JKD6008:
    SAA6008_02738 (hisG)
    JKD6159:
    SAA6159_02576 (hisG)
    LGA251:
    SARLGA251_24520 (hisG)
    M013:
    M013TW_2662
    MRSA252:
    SAR2761 (hisG)
    MSHR1132:
    SAMSHR1132_25060
    MSSA476:
    SAS2564 (hisG)
    Mu3:
    SAHV_2663 (hisG)
    Mu50:
    SAV2679 (hisG)
    MW2:
    MW2598 (hisG)
    RF122:
    SAB2555c (hisG)
    ST398:
    SAPIG2730 (hisG)
    T0131:
    SAT0131_02958
    TCH60:
    HMPREF0772_10507 (hisG)
    TW20:
    SATW20_28160 (hisG)
    USA300_TCH1516:
    USA300HOU_2680 (hisG)
    VC40:
    SAVC_12270 (hisG)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLRIAIAKGRLMDSLINYLDVIEYTTLSETLKNRERQLLLSVDNIECILVKGSDVPIYVE
    N315            MLRIAIAKGRLMDSLINYLDVIEYTTLSETLKNRERQLLLSVDNIECILVKGSDVPIYVE
    NCTC8325        MLRIAIAKGRLMDSLINYLDVIEYTTLSETLKNRERQLLLSVDNIECILVKGSDVPIYVE
    Newman          MLRIAIAKGRLMDSLINYLDVIEYTTLSETLKNRERQLLLSVDNIECILVKGSDVPIYVE
    USA300_FPR3757  MLRIAIAKGRLMDSLINYLDVIEYTTLSETLKNRERQLLLSVDNIECILVKGSDVPIYVE
                    ************************************************************

    COL             QGMADIGIVGSDILDERQYNVNNLLNMPFGACHFAVAAKPETTNYRKIATSYVHTAETYF
    N315            QGMADIGIVGSDILDERQYNVNNLLNMPFGACHFAVAAKPETTNYRKIATSYVHTAETYF
    NCTC8325        QGMADIGIVGSDILDERQYNVNNLLNMPFGACHFAVAAKPETTNYRKIATSYVHTAETYF
    Newman          QGMADIGIVGSDILDERQYNVNNLLNMPFGACHFAVAAKPETTNYRKIATSYVHTAETYF
    USA300_FPR3757  QGMADIGIVGSDILDERQYNVNNLLNMPFGACHFAVAAKPETTNYRKIATSYVHTAETYF
                    ************************************************************

    COL             KSKGIDVELIKLNGSVELACVVDMVDGIVDIVQTGTTLKANGLVEKQHISDINARLITNK
    N315            KSKGIDVELIKLNGSVELACVVDMVDGIVDIVQTGTTLKANGLVEKQHISDINARLITNK
    NCTC8325        KSKGIDVELIKLNGSVELACVVDMVDGIVDIVQTGTTLKANGLVEKQHISDINARLITNK
    Newman          KSKGIDVELIKLNGSVELACVVDMVDGIVDIVQTGTTLKANGLVEKQHISDINARLITNK
    USA300_FPR3757  KSKGIDVELIKLNGSVELAGVVDMVDGIVDIVQTGTTLKANGLVEKQHISDINARLITNK
                    ******************* ****************************************

    COL             AAYFKKSQLIEQFIRSLEVSIANA
    N315            AAYFKKSQLIEQFIRSLEVSIANA
    NCTC8325        AAYFKKSQLIEQFIRSLEVSIANA
    Newman          AAYFKKSQLIEQFIRSLEVSIANA
    USA300_FPR3757  AAYFKKSQLIEQFIRSLEVSIANA
                    ************************