From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006438000
  • symbol?:
  • description?: GNAT family acetyltransferase

      descriptions from strain specific annotations:

    • GNAT family acetyltransferase
    • acetyltransferase including N-acetylase of ribosomal protein-like protein
  • strand?: -
  • coordinates?: 6479279..6479776
  • synteny block?: BlockID0051450
  • occurrence?: in 81% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2622
    08BA02176:
    11819-97:
    MS7_2687
    71193:
    ECT-R 2:
    ECTR2_2535
    ED133:
    ED98:
    SAAV_2756
    HO 5096 0412:
    JH1:
    SaurJH1_2763
    JH9:
    SaurJH9_2706
    JKD6008:
    SAA6008_02741
    JKD6159:
    SAA6159_02579
    LGA251:
    M013:
    M013TW_2665
    MRSA252:
    SAR2764
    MSHR1132:
    SAMSHR1132_25100
    MSSA476:
    SAS2567
    Mu3:
    SAHV_2666
    Mu50:
    SAV2682
    MW2:
    MW2601
    RF122:
    SAB2558c
    ST398:
    T0131:
    SAT0131_02961
    TCH60:
    HMPREF0772_10504
    TW20:
    SATW20_28190
    USA300_TCH1516:
    USA300HOU_2684
    VC40:
    SAVC_12285

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MINTERLNLMIPSSSHLIELYNICSHPQANIYTPKGLHNSKLDTQRWIEKWRNHWQQYQF
    N315            MINTERLNLMIPSSSHLIELYNICSHPQANIYTPKGLHNSKLDTQRWIEKWQNHWQQYQF
    NCTC8325        MINTERLNLMIPSSSHLIELYNICSHPQANIYTPKGLHNSKLDTQRWIEKWRNHWQQYQF
    Newman          MINTERLNLMIPSSSHLIELYNICSHPQANIYTPKGLHNSKLDTQRWIEKWRNHWQQYQF
    USA300_FPR3757  MINTERLNLMIPSSSHLIELYNICSHPQANIYTPKGLHNSKLDTQRWIEKWRNHWQQYQF
                    ***************************************************:********

    COL             GYFVLVKKIDCSVIGICGYEYRQLKQETVLNLFYKLHPSFEGQGYACEAITAITNFVNYI
    N315            GYFVLVKKIDCSVIGICGYEYRQLKQETVLNLFYKLHPSFEGQGYACEAITAITNFVNYI
    NCTC8325        GYFVLVKKIDCSVIGICGYEYRQLKQETVLNLFYKLHPSFEGQGYACEAITAITNFVNYI
    Newman          GYFVLVKKIDCSVIGICGYEYRQLKQETVLNLFYKLHPSFEGQGYACEAITAITNFVNYI
    USA300_FPR3757  GYFVLVKKIDCSVIGICGYEYRQLKQETVLNLFYKLHPSFEGQGYACEAITAITNFVNYI
                    ************************************************************

    COL             DQETVKVIRTNKCNQRSINLAERLKFKRDDTMDDIINQGDIVFYK
    N315            DQETVKVIRTNKCNQRSINLAERLKFKRDKAMDDIINQGDIVFYK
    NCTC8325        DQETVKVIRTNKCNQRSINLAERLKFKRDDTMDDIINQGDIVFYK
    Newman          DQETVKVIRTNKCNQRSINLAERLKFKRDDTMDDIINQGDIVFYK
    USA300_FPR3757  DQETVKVIRTNKCNQRSINLAERLKFKRDDTMDDIINQGDIVFYK
                    *****************************.:**************