From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006443000
  • symbol?:
  • description?: polyisoprenoid-binding protein

      descriptions from strain specific annotations:

    • polyisoprenoid-binding protein
    • base-induced perplasmic lipid-binding protein
    • yceI-like domain protein
    • YceI like family protein
  • strand?: +
  • coordinates?: 6488191..6488706
  • synteny block?: BlockID0051500
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2627
    08BA02176:
    C248_2751
    11819-97:
    MS7_2692
    71193:
    ST398NM01_2733
    ECT-R 2:
    ECTR2_2540
    ED133:
    SAOV_2733
    ED98:
    SAAV_2761
    HO 5096 0412:
    SAEMRSA15_25880
    JH1:
    SaurJH1_2768
    JH9:
    SaurJH9_2711
    JKD6008:
    SAA6008_02746 (yceI)
    JKD6159:
    SAA6159_02584 (yceI)
    LGA251:
    SARLGA251_24550
    M013:
    M013TW_2670
    MRSA252:
    SAR2769
    MSHR1132:
    SAMSHR1132_25150
    MSSA476:
    SAS2572
    Mu3:
    SAHV_2671
    Mu50:
    SAV2687
    MW2:
    MW2606
    RF122:
    SAB2563
    ST398:
    SAPIG2733
    T0131:
    SAT0131_02966
    TCH60:
    HMPREF0772_10499
    TW20:
    SATW20_28240
    USA300_TCH1516:
    USA300HOU_2689
    VC40:
    SAVC_12310

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNFTFDGAHSSLEFQIKHLMVSKVKGSFDQFDVAVEGDINDFSTLKATATIIPSSINTK
    N315            MTNFTFDGAHSSLEFQIKHLMVSKVKGSFDQFDVAVEGDINDFSTLKATATIIPSSINTK
    NCTC8325        MTNFTFDGAHSSLEFQIKHLMVSKVKGSFDQFDVAVEGDINDFSTLKATATIIPSSINTK
    Newman          MTNFTFDGAHSSLEFQIKHLMVSKVKGSFDQFDVAVEGDINDFSTLKATATIIPSSINTK
    USA300_FPR3757  MTNFTFDGAHSSLEFQIKHLMVSKVKGSFDQFDVAVEGDINDFSTLKATATIIPSSINTK
                    ************************************************************

    COL             NEARDNHLKSGDFFGTDEFDKITFVTKSVSESKVVGDLTIKGITNEETFDVEFNGVSKNP
    N315            NEARDNHLKSGDFFGTDEFDKITFETKSVTENKVVGDLTIKGITNEETFDVEFNGVSKNP
    NCTC8325        NEARDNHLKSGDFFGTDEFDKITFVTKSVSESKVVGDLTIKGITNEETFDVEFNGVSKNP
    Newman          NEARDNHLKSGDFFGTDEFDKITFVTKSVSESKVVGDLTIKGITNEETFDVEFNGVSKNP
    USA300_FPR3757  NEARDNHLKSGDFFGTDEFDKITFVTKSVSESKVVGDLTIKGITNEETFDVEFNGVSKNP
                    ************************ ****:*.****************************

    COL             MDGSQVTGIIVTGTINREKYGINFNQALETGGVMLGKDVKFEASAEFSISE
    N315            MDGSQVTGVIVTGTINRENYGINFNQALETGGVMLGKDVKFEASAEFSISE
    NCTC8325        MDGSQVTGIIVTGTINREKYGINFNQALETGGVMLGKDVKFEASAEFSISE
    Newman          MDGSQVTGIIVTGTINREKYGINFNQALETGGVMLGKDVKFEASAEFSISE
    USA300_FPR3757  MDGSQVTGIIVTGTINREKYGINFNQALETGGVMLGKDVKFEASAEFSISE
                    ********:*********:********************************