From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006448000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 6492397..6493164
  • synteny block?: BlockID0051550
  • occurrence?: in 63% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2631
    08BA02176:
    C248_2755
    11819-97:
    MS7_2697
    71193:
    ST398NM01_2737
    ECT-R 2:
    ECTR2_2544
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    SaurJH1_2772
    JH9:
    SaurJH9_2715
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    M013TW_2674
    MRSA252:
    MSHR1132:
    SAMSHR1132_25200
    MSSA476:
    Mu3:
    SAHV_2675
    Mu50:
    SAV2691
    MW2:
    RF122:
    SAB2567c
    ST398:
    SAPIG2737
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_2693
    VC40:
    SAVC_12330

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLSKQSQDFLEKLRVELLFRGKTEAEVEELLEELEDHLTMAEKNNEDTSSIINTPIKSMA
    N315            MLTKQSQDFLEKLRVELLFRGKTEAEVEELLEELEDHLTMAEKNNEDTSSIINTPIKSMA
    NCTC8325        MLSKQSQDFLEKLRVELLFRGKTEAEVEELLEELEDHLTMAEKNNEDTSSIINTPIKSMA
    Newman          MLSKQSQDFLEKLRVELLFRGKTEAEVEELLEELEDHLTMAEKNNEDTSSIINTPIKSMA
    USA300_FPR3757  MLSKQSQDFLEKLRVELLFRGKTEAEVEELLEELEDHLTMAEKNNEDTSSIINTPIKSMA
                    **:*********************************************************

    COL             DQLSPEISLTTGLYKYITLYFAFILAVIIIPRFLDLGTFDVTIAFLLYIASIVILGVVIG
    N315            DQLSPEISLTTGLYKYITLYFSFILAVIIIPRFLDLGTFDVTIAFLLYIASIVILGVVIG
    NCTC8325        DQLSPEISLTTGLYKYITLYFAFILAVIIIPRFLDLGTFDVTIAFLLYIASIVILGVVIG
    Newman          DQLSPEISLTTGLYKYITLYFAFILAVIIIPRFLDLGTFDVTIAFLLYIASIVILGVVIG
    USA300_FPR3757  DQLSPEISLTTGLYKYITLYFAFILAVIIIPRFLDLGTFDVTIAFLLYIASIVILGVVIG
                    *********************:**************************************

    COL             MLILRNTLVRFGDQKITYVINVTYGIIVFLWMILGGLIIKKYPIYSFFELSDKQSFIVGL
    N315            MLILRNTLVRFGDQKITYVINVTYGIVVFLWMIFGGLIIKKYPIYSFFELSDKQSFIVGL
    NCTC8325        MLILRNTLVRFGDQKITYVINVTYGIIVFLWMILGGLIIKKYPIYSFFELSDKQSFIVGL
    Newman          MLILRNTLVRFGDQKITYVINVTYGIIVFLWMILGGLIIKKYPIYSFFELSDKQSFIVGL
    USA300_FPR3757  MLILRNTLVRFGDQKITYVINVTYGIIVFLWMILGGLIIKKYPIYSFFELSDKQSFIVGL
                    **************************:******:**************************

    COL             VLLIALIGTCILIKQKIYALIVLVISLPSLIARIAAIFSKEPDTFNLVSVSILIILNIAF
    N315            VLLIALIVICILIKQKIYALIVLVISLPSLIARIAAIFSKEPDTFNLVSVSILIILNIAF
    NCTC8325        VLLIALIGTCILIKQKIYALIVLVISLPSLIARIAAIFSKEPDTFNLVSVSILIILNIAF
    Newman          VLLIALIGTCILIKQKIYALIVLVISLPSLIARIAAIFSKEPDTFNLVSVSILIILNIAF
    USA300_FPR3757  VLLIALIGTCILIKQKIYALIVLVISLPSLIARIAAIFSKEPDTFNLVSVSILIILNIAF
                    *******  ***************************************************

    COL             IIYTFVNFRKLKKED
    N315            IIYTFVNFRKLKKED
    NCTC8325        IIYTFVNFRKLKKED
    Newman          IIYTFVNFRKLKKED
    USA300_FPR3757  IIYTFVNFRKLKKED
                    ***************