From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006450000
  • symbol?: bstA
  • description?: dinB superfamily protein
  • strand?: +
  • coordinates?: 6493653..6494136
  • synteny block?: BlockID0051570
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2633
    08BA02176:
    C248_2757
    11819-97:
    MS7_2699
    71193:
    ST398NM01_2739
    ECT-R 2:
    ECTR2_2546
    ED133:
    SAOV_2737
    ED98:
    SAAV_2766
    HO 5096 0412:
    SAEMRSA15_25920
    JH1:
    SaurJH1_2774
    JH9:
    SaurJH9_2717
    JKD6008:
    SAA6008_02750
    JKD6159:
    SAA6159_02588
    LGA251:
    SARLGA251_24590
    M013:
    M013TW_2676
    MRSA252:
    SAR2773
    MSHR1132:
    SAMSHR1132_25220
    MSSA476:
    SAS2577
    Mu3:
    SAHV_2677
    Mu50:
    SAV2693
    MW2:
    MW2611
    RF122:
    SAB2569
    ST398:
    SAPIG2739
    T0131:
    SAT0131_02970
    TCH60:
    HMPREF0772_10495
    TW20:
    SATW20_28280
    USA300_TCH1516:
    USA300HOU_2695
    VC40:
    SAVC_12340

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTTKTVFDVIDMGLGYLVNVYDAWKVEKVLDDYHKPFSNTIHWQFGHVLTIFESALAVAG
    N315            MTTKTVFDVIDMGLGYLVNVYDAWKVEKVLDDYHEPFSNTIHWQFGHVLTIFESALAVAG
    NCTC8325        MTTKTVFDVIDMGLGYLVNVYDAWKVEKVLDDYHKPFSNTIHWQFGHVLTIFESALAVAG
    Newman          MTTKTVFDVIDMGLGYLVNVYDAWKVEKVLDDYHKPFSNTIHWQFGHVLTIFESALAVAG
    USA300_FPR3757  MTTKTVFDVIDMGLGYLVNVYDAWKVEKVLDDYHKPFSNTIHWQFGHVLTIFESALAVAG
                    **********************************:*************************

    COL             KENIDLNIYRPLFGNGSSPDEWKDEVPSIERILEGLQTLPERARNLTEDDLAIELKQPIV
    N315            KENIDLNIYRPLFGNGSSPDEWKDEVPSIEKILEGLQTLPERARNLTEDDLAIELKQPIV
    NCTC8325        KENIDLNIYRPLFGNGSSPDEWKDEVPSIERILEGLQTLPERARNLTEDDLAIELKQPIV
    Newman          KENIDLNIYRPLFGNGSSPDEWKDEVPSIERILEGLQTLPERARNLTEDDLAIELKQPIV
    USA300_FPR3757  KENIDLNIYRPLFGNGSSPDEWKDEVPSIERILEGLQTLPERARNLTEDDLAIELKQPIV
                    ******************************:*****************************

    COL             GCNNLEELLVLNAIHIPLHAGKIEEMSRILKNLK
    N315            GCNNLEELLVLNAIHIPLHAGKIEEMSRILKNLK
    NCTC8325        GCNNLEELLVLNAIHIPLHAGKIEEMSRILKNLK
    Newman          GCNNLEELLVLNAIHIPLHAGKIEEMSRILKNLK
    USA300_FPR3757  GCNNLEELLVLNAIHIPLHAGKIEEMSRILKNLK
                    **********************************