From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006457000
  • symbol?: rarD
  • description?: rarD protein

      descriptions from strain specific annotations:

    • rarD protein
    • transporter DMT superfamily protein
    • protein RarD
    • eamA-like transporter family protein
    • DMT superfamily drug/metabolite transporter
    • DMT superfamily drug/metabolite transporter RarD
    • chloramphenicol-sensitive protein
  • strand?: -
  • coordinates?: 6502011..6502835
  • synteny block?: BlockID0051640
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2719 (rarD)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2635 (rarD)
    08BA02176:
    C248_2762
    11819-97:
    MS7_2701
    71193:
    ST398NM01_2742
    ECT-R 2:
    ECTR2_2548
    ED133:
    SAOV_2739c
    ED98:
    SAAV_2768 (rarD)
    HO 5096 0412:
    SAEMRSA15_25950
    JH1:
    SaurJH1_2776
    JH9:
    SaurJH9_2719
    JKD6008:
    SAA6008_02753 (rarD)
    JKD6159:
    SAA6159_02590 (rarD)
    LGA251:
    SARLGA251_24620
    M013:
    M013TW_2678
    MRSA252:
    SAR2776
    MSHR1132:
    SAMSHR1132_25240
    MSSA476:
    SAS2580
    Mu3:
    SAHV_2680
    Mu50:
    SAV2696
    MW2:
    MW2615
    RF122:
    SAB2572c
    ST398:
    SAPIG2742 (rarD)
    T0131:
    SAT0131_02973
    TCH60:
    HMPREF0772_10491 (rarD)
    TW20:
    SATW20_28310
    USA300_TCH1516:
    USA300HOU_2697 (rarD)
    VC40:
    SAVC_12350

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNSEYKKGIFLALSAYILWGILPIYWQFVDAIGAFEILAFRIIFSAIFMIFILAVGQKQR
    N315            MNIEYKKGIFLALSAYILWGILPIYWQFVDAIGAFEILAFRIIFSAIFMIFILAVGQKQR
    NCTC8325        MNSEYKKGIFLALSAYILWGILPIYWQFVDAIGAFEILAFRIIFSAIFMIFILAVGQKQR
    Newman          MNSEYKKGIFLALSAYILWGILPIYWQFVDAIGAFEILAFRIIFSAIFMIFILAVGQKQR
    USA300_FPR3757  MNSEYKKGIFLALSAYILWGILPIYWQFVDAIGAFEILAFRIIFSAIFMIFILAVGQKQR
                    ** *********************************************************

    COL             NAFQRDMNQLLGKPIQLLAIVVAGYVITLNWGTFIWAVTNGHVLQTSLGYYINPLVSILL
    N315            NAFQRDMNQLLGKPIQLLAIVVAGYVITLNWGTFIWAVTNGHVLQTSLGYYINPLVSILL
    NCTC8325        NAFQRDMNQLLGKPIQLLAIVVAGYVITLNWGTFIWAVTNGHVLQTSLGYYINPLVSILL
    Newman          NAFQRDMNQLLGKPIQLLAIVVAGYVITLNWGTFIWAVTNGHVLQTSLGYYINPLVSILL
    USA300_FPR3757  NAFQRDMNQLLGKPIQLLAIVVAGYVITLNWGTFIWAVTNGHVLQTSLGYYINPLVSILL
                    ************************************************************

    COL             ALIFLKERFNKFEWLAILFAFIGVLYMTLKIGEFPIVSIILALSFGTYGLLKKVVHIDAI
    N315            ALIFLKERFNKFEWLAILFAFIGVLYMTLKIGEFPIVSIILALSFGTYGLLKKVVHIDAI
    NCTC8325        ALIFLKERFNKFEWLAILFAFIGVLYMTLKIGEFPIVSIILALSFGTYGLLKKVVHIDAI
    Newman          ALIFLKERFNKFEWLAILFAFIGVLYMTLKIGEFPIVSIILALSFGTYGLLKKVVHIDAI
    USA300_FPR3757  ALIFLKERFNKFEWLAILFAFIGVLYMTLKIGEFPIVSIILALSFGTYGLLKKVVHIDAI
                    ************************************************************

    COL             SSITIECIVTAPAGLIYVIYLWQQHQMSFGLNMSSFWLLFSGAITAIPLILFSAGAKRIP
    N315            SSITIECIVTAPAGLIYVIYLWQQHQMSFGLNMSSFWLLFSGAITAIPLILFSAGAKRIP
    NCTC8325        SSITIECIVTAPAGLIYVIYLWQQHQMSFGLNMSSFWLLFSGAITAIPLILFSAGAKRIP
    Newman          SSITIECIVTAPAGLIYVIYLWQQHQMSFGLNMSSFWLLFSGAITAIPLILFSAGAKRIP
    USA300_FPR3757  SSITIECIVTAPAGLIYVIYLWQQHQMSFGLNMSSFWLLFSGAITAIPLILFSAGAKRIP
                    ************************************************************

    COL             LSLIGFIQYVGPTIMFVLGIFVFKEPFSIDQLITFIFIWTGIVLYSLSQYIKLKKHPVAK
    N315            LSLIGFIQYVGPTIMFVLGIFVFKEPFSIDQLITFIFIWTGIVLYSLSQYIKLKKHPVAK
    NCTC8325        LSLIGFIQYVGPTIMFVLGIFVFKEPFSIDQLITFIFIWTGIVLYSLSQYIKLKKHPVAK
    Newman          LSLIGFIQYVGPTIMFVLGIFVFKEPFSIDQLITFIFIWTGIVLYSLSQYIKLKKHPVAK
    USA300_FPR3757  LSLIGFIQYVGPTIMFVLGIFVFKEPFSIDQLITFIFIWTGIVLYSLSQYIKLKKHPVAK
                    ************************************************************

    COL             TL
    N315            TL
    NCTC8325        TL
    Newman          TL
    USA300_FPR3757  TL
                    **