From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006458000
  • symbol?:
  • description?: DNA-binding protein

      descriptions from strain specific annotations:

    • DNA-binding protein
    • putative DNA-binding protein
    • prolyl-tRNA synthetase
  • strand?: +
  • coordinates?: 6503205..6503780
  • synteny block?: BlockID0051650
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2636
    08BA02176:
    C248_2763
    11819-97:
    MS7_2702
    71193:
    ST398NM01_2743
    ECT-R 2:
    ECTR2_2549
    ED133:
    SAOV_2740
    ED98:
    SAAV_2769
    HO 5096 0412:
    SAEMRSA15_25960
    JH1:
    SaurJH1_2777
    JH9:
    SaurJH9_2720
    JKD6008:
    SAA6008_02754
    JKD6159:
    SAA6159_02591
    LGA251:
    SARLGA251_24630
    M013:
    M013TW_2679
    MRSA252:
    SAR2777
    MSHR1132:
    SAMSHR1132_25250
    MSSA476:
    SAS2581
    Mu3:
    SAHV_2681
    Mu50:
    SAV2697
    MW2:
    MW2616
    RF122:
    SAB2573
    ST398:
    SAPIG2743
    T0131:
    SAT0131_02974
    TCH60:
    HMPREF0772_10490
    TW20:
    SATW20_28320
    USA300_TCH1516:
    USA300HOU_2698
    VC40:
    SAVC_12355

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTLPKIGKPATRALNSQGIYTLEAVSQYTKSSLMEMHGVGPKAISILEQALFQHQLHFKT
    N315            MTLPKIGKPATRALNSQGIYTLEAVSQYTKSSLMEMHGVGPKAISILEQALFQHQLHFKT
    NCTC8325        MTLPKIGKPATRALNSQGIYTLEAVSQYTKSSLMEMHGVGPKAISILEQALFQHQLHFKT
    Newman          MTLPKIGKPATRALNSQGIYTLEAVSQYTKSSLMEMHGVGPKAISILEQALFQHQLHFKT
    USA300_FPR3757  MTLPKIGKPATRALNSQGIYTLEAVSQYTKSSLMEMHGVGPKAISILEQALFQHQLHFKT
                    ************************************************************

    COL             EVQSSLPFKLTGDVSCNHAPKRQQMIDFIVVTAALDIELLRSLVTTEFIWSVPGRFDIYG
    N315            EVQSSLPFKLTGDVSCNHAPKRQQMIDFIVATAALDIELLRSLVTTEFIWSVPGHFDIYG
    NCTC8325        EVQSSLPFKLTGDVSCNHAPKRQQMIDFIVVTAALDIELLRSLVTTEFIWSVPGRFDIYG
    Newman          EVQSSLPFKLTGDVSCNHAPKRQQMIDFIVVTAALDIELLRSLVTTEFIWSVPGRFDIYG
    USA300_FPR3757  EVQSSLPFKLTGDVSCNHAPKRQQMIDFIVVTAALDIELLRSLVTTEFIWSVPGRFDIYG
                    ******************************.***********************:*****

    COL             PQILIQELSNHYNQVASLNIHSSITHGCLGSMHGIEILKTGKEIHFAHFFEFENHKKDAK
    N315            PQILIQELSNYYNQVASLNIHSNITHGCLGSMHGIEILKTGKEIHFAHFFEFENHKKDAK
    NCTC8325        PQILIQELSNHYNQVASLNIHSSITHGCLGSMHGIEILKTGKEIHFAHFFEFENHKKDAK
    Newman          PQILIQELSNHYNQVASLNIHSSITHGCLGSMHGIEILKTGKEIHFAHFFEFENHKKDAK
    USA300_FPR3757  PQILIQELSNHYNQVASLNIHSSITHGCLGSMHGIEILKTGKEIHFAHFFEFENHKKDAK
                    **********:***********.*************************************

    COL             LSKVTSYIVVG
    N315            LSKVTSYIVVA
    NCTC8325        LSKVTSYIVVG
    Newman          LSKVTSYIVVG
    USA300_FPR3757  LSKVTSYIVVG
                    **********.