Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006461000
  • symbol?:
  • description?: N-hydroxyarylamine O-acetyltransferase

      descriptions from strain specific annotations:

    • N-hydroxyarylamine O-acetyltransferase
    • N-acetyltransferase
    • N-acetyltransferase family protein
    • putative N-acetyltransferase
    • arylamine N-acetyltransferase
  • strand?: +
  • coordinates?: 6505203..6506009
  • synteny block?: BlockID0051680
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2638
    08BA02176:
    C248_2765
    11819-97:
    MS7_2704
    71193:
    ST398NM01_2745
    ECT-R 2:
    ECTR2_2551
    ED133:
    SAOV_2742
    ED98:
    SAAV_2771
    HO 5096 0412:
    SAEMRSA15_25980
    JH1:
    SaurJH1_2779
    JH9:
    SaurJH9_2722
    JKD6008:
    SAA6008_02756
    JKD6159:
    SAA6159_02593
    LGA251:
    SARLGA251_24650
    M013:
    M013TW_2681
    MRSA252:
    SAR2779
    MSHR1132:
    SAMSHR1132_25270
    MSSA476:
    SAS2583
    Mu3:
    SAHV_2683
    Mu50:
    SAV2699
    MW2:
    MW2618
    RF122:
    SAB2575
    ST398:
    SAPIG2745
    T0131:
    SAT0131_02976
    TCH60:
    HMPREF0772_10488
    TW20:
    SATW20_28340
    USA300_TCH1516:
    USA300HOU_2701
    VC40:
    SAVC_12365

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --MNIAKLENYLQIDSSRYNRPSIEALNYYATRFMLTVPFENIDVQNSKPISINIDALFN
    N315            MLMNIAKLENYLQIDSSRYNRPSIEALNYYATRFMLTVPFENIDVQNSKPISINIDALFN
    NCTC8325        --MNIAKLENYLQIDSSRYNRPSIEALNYYATRFMLTVPFENIDVQNSKPISINIDALFN
    Newman          --MNIAKLENYLQIDSSRYNRPSIEALNYYATRFMLTVPFENIDVQNSKPISINIDALFN
    USA300_FPR3757  --MNIAKLENYLQIDSSRYNRPSIEALNYYATRFMLTVPFENIDVQNSKPISINIDALFN
                      **********************************************************

    COL             KIVHDKRGGFCYELNTFFKAYLQQKGFNPELMSATIHTPGGGRSLNGSHASLVVSINDVF
    N315            KIVHDKRGGFCYELNTFFKAYLQQKGFNPELMSATIHTPGGGRSLNGSHASLVVSINDVF
    NCTC8325        KIVHDKRGGFCYELNTFFKAYLQQKGFNPELMSATIHTPGGGRSLNGSHASLVVSINDVF
    Newman          KIVHDKRGGFCYELNTFFKAYLQQKGFNPELMSATIHTPGGGRSLNGSHASLVVSINDVF
    USA300_FPR3757  KIVHDKRGGFCYELNTFFKAYLQQKGFNPELMSATIHTPGGGRSLNGSHASLVVSINDVF
                    ************************************************************

    COL             YVTDVGFGDLPLHAIPITSSEHTQPITDISGTFRAIFNNEDKDIFYVQKFENDHWHTKYE
    N315            YVTDVGFGDLPLHAIPITSSEHTQPITDISGTFRAIFNNEDKDIFYVQKFENDHWHTKYE
    NCTC8325        YVTDVGFGDLPLHAIPITSSEHTQPITDISGTFRAIFNNEDKDIFYVQKFENDHWHTKYE
    Newman          YVTDVGFGDLPLHAIPITSSEHTQPITDISGTFRAIFNNEDKDIFYVQKFENDHWHTKYE
    USA300_FPR3757  YVTDVGFGDLPLHAIPITSSEHTQPITDISGTFRAIFNNEDKDIFYVQKFENDHWHTKYE
                    ************************************************************

    COL             AEFKPKQIEDFNSNIEYNQTHPDSIFVQHLLITMPQSFGRATMSENHLTLTRNGSSEKFD
    N315            AEFKPKQIEDFNSNIEYNQTHPDSIFVQHLLITMPQSFGRATMSENHLTLTRNGSSEKFD
    NCTC8325        AEFKPKQIEDFNSNIEYNQTHPDSIFVQHLLITMPQSFGRATMSENHLTLTRNGSSEKFD
    Newman          AEFKPKQIEDFNSNIEYNQTHPDSIFVQHLLITMPQSFGRATMSENHLTLTRNGSSEKFD
    USA300_FPR3757  AEFKPKQIEDFNSNIEYNQTHPDSIFVQHLLITMPQSFGRATMSENHLTLTRNGSSEKFD
                    ************************************************************

    COL             VTKDNYKHFLEKYFGLNVTINRIEKQ
    N315            VTKDNYKHFLEKYFGLNVTINRIEKQ
    NCTC8325        VTKDNYKHFLEKYFGLNVTINRIEKQ
    Newman          VTKDNYKHFLEKYFGLNVTINRIEKQ
    USA300_FPR3757  VTKDNYKHFLEKYFGLNVTINRIEKQ
                    **************************