From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006464000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • membrane spanning protein
  • strand?: -
  • coordinates?: 6506406..6506919
  • synteny block?: BlockID0051710
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2639
    08BA02176:
    C248_2766
    11819-97:
    MS7_2705
    71193:
    ST398NM01_2746
    ECT-R 2:
    ECTR2_2552
    ED133:
    SAOV_2743c
    ED98:
    SAAV_2772
    HO 5096 0412:
    SAEMRSA15_25990
    JH1:
    SaurJH1_2780
    JH9:
    SaurJH9_2723
    JKD6008:
    SAA6008_02757 (hdeD)
    JKD6159:
    SAA6159_02594 (hdeD)
    LGA251:
    SARLGA251_24660
    M013:
    M013TW_2683
    MRSA252:
    SAR2780
    MSHR1132:
    SAMSHR1132_25280
    MSSA476:
    SAS2584
    Mu3:
    SAHV_2684
    Mu50:
    SAV2700
    MW2:
    MW2619
    RF122:
    SAB2577c
    ST398:
    SAPIG2746
    T0131:
    SAT0131_02977
    TCH60:
    HMPREF0772_10487
    TW20:
    SATW20_28350
    USA300_TCH1516:
    USA300HOU_2702
    VC40:
    SAVC_12370

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEKGNQGIKWSSLIMGVLLLMLAVVIFTFPIENFYAITWLIGLFVLINGVIQIVYRRKAK
    N315            MEKGNQGIKWSSLIMGVLLLMLAVVIFTFPIENFYAITWLIGLFVLINGVIQIIYRRKAK
    NCTC8325        MEKGNQGIKWSSLIMGVLLLMLAVVIFTFPIENFYAITWLIGLFVLINGVIQIVYRRKAK
    Newman          MEKGNQGIKWSSLIMGVLLLMLAVVIFTFPIENFYAITWLIGLFVLINGVIQIVYRRKAK
    USA300_FPR3757  MEKGNQGIKWSSLIMGVLLLMLAVVIFTFPIENFYAITWLIGLFVLINGVIQIVYRRKAK
                    *****************************************************:******

    COL             ALVGGNQNWILFMGIVDILFGLLVIFNVGASSAFFIYMFAFWFIFSSISGLFTFSGSGSL
    N315            ALVGGNQNWILFMGIVDILFGLIVIFNVGASSAFFIYMFAFWFIFSSIAGLFTFTGSGSL
    NCTC8325        ALVGGNQNWILFMGIVDILFGLLVIFNVGASSAFFIYMFAFWFIFSSISGLFTFSGSGSL
    Newman          ALVGGNQNWILFMGIVDILFGLLVIFNVGASSAFFIYMFAFWFIFSSISGLFTFSGSGSL
    USA300_FPR3757  ALVGGNQNWILFMGIVDILFGLLVIFNVGASSAFFIYMFAFWFIFSSISGLFTFSGSGSL
                    **********************:*************************:*****:*****

    COL             KLISVIFNLLGIVFGVILLFNPLMGIVFISTMIAIAFVFVGVIYVVDALA
    N315            KLISVIFNLLGIVFGVILLFNPLMGIVFISTMIAIAFVFVGVIYVVDALA
    NCTC8325        KLISVIFNLLGIVFGVILLFNPLMGIVFISTMIAIAFVFVGVIYVVDALA
    Newman          KLISVIFNLLGIVFGVILLFNPLMGIVFISTMIAIAFVFVGVIYVVDALA
    USA300_FPR3757  KLISVIFNLLGIVFGVILLFNPLMGIVFISTMIAIAFVFVGVIYVVDALA
                    **************************************************