From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006466000
  • symbol?: vraE
  • description?: vraE protein

      descriptions from strain specific annotations:

    • vraE protein
    • Bacitracin export permease protein BceB
    • permease family protein
    • ABC transporter permease
    • ABC transporter permease, involved in vancomycin resistance
    • ABC transporter ATP-binding protein
    • ftsX-like permease family protein
    • ABC transporter permease protein, involved in vancomycin resistance
    • ABC superfamily ATP binding cassette transporter, membrane protein
  • strand?: +
  • coordinates?: 6507948..6509840
  • synteny block?: BlockID0051730
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2493 (vraE)
    NCTC8325:
    Newman:
    NWMN_2599 (vraE)
    USA300_FPR3757:
    04-02981:
    SA2981_2641 (bceB)
    08BA02176:
    C248_2768 (vraE)
    11819-97:
    MS7_2707
    71193:
    ST398NM01_2748
    ECT-R 2:
    ECTR2_2554
    ED133:
    SAOV_2745
    ED98:
    SAAV_2774
    HO 5096 0412:
    SAEMRSA15_26010 (vraE)
    JH1:
    SaurJH1_2782
    JH9:
    SaurJH9_2725
    JKD6008:
    SAA6008_02759 (vraE)
    JKD6159:
    SAA6159_02596 (vraE)
    LGA251:
    SARLGA251_24680 (vraE)
    M013:
    M013TW_2685
    MRSA252:
    SAR2782 (vraE)
    MSHR1132:
    SAMSHR1132_25300
    MSSA476:
    SAS2586
    Mu3:
    SAHV_2686 (vraE)
    Mu50:
    SAV2702 (vraE)
    MW2:
    MW2621 (vraE)
    RF122:
    SAB2579 (vraE)
    ST398:
    SAPIG2748
    T0131:
    SAT0131_02979 (gidB)
    TCH60:
    HMPREF0772_10485 (vraE)
    TW20:
    SATW20_28370 (vraE)
    USA300_TCH1516:
    USA300HOU_2704
    VC40:
    SAVC_12380

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTFNHIVFKNLRQNLKHYAMYLFSLFFSIVLYFSFTTLQFTKGVNNDDSMAIIKKGALVG
    N315            MTFNHIVFKNLRQNLKHYAMYLFSLFFSIVLYFSFTTLQFTKGVNNDDSMAIIKKGALVG
    NCTC8325        MTFNHIVFKNLRQNLKHYAMYLFSLFFSIVLYFSFTTLQFTKGVNNDDSMAIIKKGALVG
    Newman          MTFNHIVFKNLRQNLKHYAMYLFSLFFSIVLYFSFTTLQFTKGVNNDDSMAIIKKGALVG
    USA300_FPR3757  MTFNHIVFKNLRQNLKHYAMYLFSLFFSIVLYFSFTTLQFTKGVNNDDSMAIIKKGALVG
                    ************************************************************

    COL             SIFLFIIIVIFLMYANHLFVKRRTREFALFQLIGLTRQNILKMLALEQMIVFLITGVVGV
    N315            SIFLFIIIVIFLMYANHLFVKRRTREFALFQLIGLTRQNILKMLALEQMIVFLITGVVGV
    NCTC8325        SIFLFIIIVIFLMYANHLFVKRRTREFALFQLIGLTRQNILKMLALEQMIVFLITGVVGV
    Newman          SIFLFIIIVIFLMYANHLFVKRRTREFALFQLIGLTRQNILKMLALEQMIVFLITGVVGV
    USA300_FPR3757  SIFLFIIIVIFLMYANHLFVKRRTREFALFQLIGLTRQNILKMLALEQMIVFLITGVVGV
                    ************************************************************

    COL             LCGIAGAQLLLSIVSKLMSLSINLSIHFEPMALVLTIFMLIIAYVLILFKSALFLKRRSI
    N315            LCGIAGAQLLLSIVSKLMSLSINLSIHFEPMALVLTIFMLIIAYVLILFQSALFLKRRSI
    NCTC8325        LCGIAGAQLLLSIVSKLMSLSINLSIHFEPMALVLTIFMLIIAYVLILFQSALFLKRRSI
    Newman          LCGIAGAQLLLSIVSKLMSLSINLSIHFEPMALVLTIFMLIIAYVLILFKSALFLKRRSI
    USA300_FPR3757  LCGIAGAQLLLSIVSKLMSLSINLSIHFEPMALVLTIFMLIIAYVLILFKSALFLKRRSI
                    *************************************************:**********

    COL             LSMMKDSIKTDATTAKVTTAEVISGVLGIAMIALGYYMATEMFGTFKALTMAMTSPFIIL
    N315            LSMMKDSIKTDATTAKVTTAEVISGVLGIAMIALGYYMATEMFGTFKALTMAMTSPFIIL
    NCTC8325        LSMMKDSIKTDATTAKVTTAEVISGVLGIAMIALGYYMATEMFGTFKALTMAMTSPFIIL
    Newman          LSMMKDSIKTDATTAKVTTAEVISGVLGIAMIALGYYMATEMFGTFKALTMAMTSPFIIL
    USA300_FPR3757  LSMMKDSIKTDATTAKVTTAEVISGVLGIAMIALGYYMATEMFGTFKALTMAMTSPFIIL
                    ************************************************************

    COL             FLTVVGAYLFFRSSVSLIFKTLKKSKNGRVSITDVVFTSSIMYRMKKNAMSLTIIAIISA
    N315            FLTVVGAYLFFRSSVSLIFKTLKKSKNGRVSITDVVFTSSIMYRMKKNAMSLTIIAIISA
    NCTC8325        FLTVVGAYLFFRSSVSLIFKTLKKSKNGRVSITDVVFTSSIMYRMKKNAMSLTIIAIISA
    Newman          FLTVVGAYLFFRSSVSLIFKTLKKSKNGRVSITDVVFTSSIMYRMKKNAMSLTIIAIISA
    USA300_FPR3757  FLTVVGAYLFFRSSVSLIFKTLKKSKNGRVSITDVVFTSSIMYRMKKNAMSLTIIAIISA
                    ************************************************************

    COL             VTVTVLCFAALSKSNTDQTLTSMAPNEFNVVATQDAKQFETKLSQQQITFSKNAYETITV
    N315            VTVTVLCFAALSKSNTDQTLTSMAPNEFNVVATQDAKQFETKLSQQQITFSKNAYETITV
    NCTC8325        VTVTVLCFAALSKSNTDQTLTSMAPNEFNVVATQDAKQFETKLSQQQITFSKNAYETITV
    Newman          VTVTVLCFAALSKSNTDQTLTSMAPNEFNVVATQDAKQFETKLSQQQITFSKNAYETITV
    USA300_FPR3757  VTVTVLCFAALSKSNTDQTLTSMAPNEFNVVATQDAKQFETKLSQQQITFSKNAYETITV
                    ************************************************************

    COL             DNVNDQVITLENGSDSGRTNSILSANNKLTGNNAIITNTKSLPNIINIHLNKDLVVKGTK
    N315            DNVKDQVITLENGSDSGRTNSILSANNKVTGNNAIITNTKSLPNIINIHLNKDLVVKGTK
    NCTC8325        DNVNDQVITLENGSDSGRTNSILSANNKLTGNNAIITNTKSLPNIINIHLNKDLVVKGTK
    Newman          DNVNDQVITLENGSDSGRTNSILSANNKLTGNNAIITNTKSLPNIINIHLNKDLVVKGTK
    USA300_FPR3757  DNVNDQVITLENGSDSGRTNSILSANNKLTGNNAIITNTKSLPNIINIHLNKDLVVKGTK
                    ***:************************:*******************************

    COL             NETFRVTQEDKGKVYPLNLSFNSPVIEVSPEKYQQLKTQNNVHTFYGYDIKQTSQKEKAQ
    N315            NETFRVTQEDKGRVYPLNLSFNSPVVEVSPEKYQQLKTQNNVHTFYGYDIKQTSQKEKAQ
    NCTC8325        NETFRVTQEDKGKVYPLNLSFNSPVIEVSPEKYQQLKTQNNVHTFYGYDIKQTSQKEKAQ
    Newman          NETFRVTQEDKGKVYPLNLSFNSPVIEVSPEKYQQLKTQNNVHTFYGYDIKQTSQKEKAQ
    USA300_FPR3757  NETFRVTQEDKGKVYPLNLSFNSPVIEVSPEKYQQLKTQNNVHTFYGYDIKQTSQKEKAQ
                    ************:************:**********************************

    COL             AIAKQFGDKVITYDEMKKEVDATNGILIFVTSFLGLAFLVAAGCIIYIKQMDETEDELSN
    N315            AIAKQFGDKVITYDEMKKEVDATNGILIFVTSFLGLAFLVAAGCIIYIKQMDETEDELSN
    NCTC8325        AIAKQFGDKVITYDEMKKEVDATNGILIFVTSFLGLAFLVAAGCIIYIKQMDETEDELSN
    Newman          AIAKQFGDKVITYDEMKKEVDATNGILIFVTSFLGLAFLVAAGCIIYIKQMDETEDELSN
    USA300_FPR3757  AIAKQFGDKVITYDEMKKEVDATNGILIFVTSFLGLAFLVAAGCIIYIKQMDETEDELSN
                    ************************************************************

    COL             FRILKRIGFTHTDMLKGLLLKITFNFGLPLLIAILHAVFAAIAFMKLMGNISFMPVIVVI
    N315            FRILKRIGFTHTDMLKGLLLKITFNFGLPLLIAILHAVFAAIAFMKLMGNISFMPVIVVI
    NCTC8325        FRILKRIGFTHTDMLKGLLLKITFNFGLPLLIAILHAVFAAIAFMKLMGNISFMPVIVVI
    Newman          FRILKRIGFTHTDMLKGLLLKITFNFGLPLLIAILHAVFAAIAFMKLMGNISFMPVIVVI
    USA300_FPR3757  FRILKRIGFTHTDMLKGLLLKITFNFGLPLLIAILHAVFAAIAFMKLMGNISFMPVIVVI
                    ************************************************************

    COL             VVYTLIYITFALIAFVHSNKLIKKTI
    N315            VVYTLIYITFALIAFVHSNKLIKKTI
    NCTC8325        VVYTLIYITFALIAFIHSNKLIKKTI
    Newman          VVYTLIYITFALIAFVHSNKLIKKTI
    USA300_FPR3757  VVYTLIYITFALIAFVHSNKLIKKTI
                    ***************:**********