From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006468000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 6509935..6510126
  • synteny block?: BlockID0051750
  • occurrence?: in 78% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2642
    08BA02176:
    C248_2769
    11819-97:
    71193:
    ST398NM01_2749
    ECT-R 2:
    ECTR2_2555
    ED133:
    ED98:
    SAAV_2775
    HO 5096 0412:
    JH1:
    SaurJH1_2783
    JH9:
    SaurJH9_2726
    JKD6008:
    SAA6008_02760
    JKD6159:
    SAA6159_02597
    LGA251:
    M013:
    M013TW_2686
    MRSA252:
    SAR2783
    MSHR1132:
    SAMSHR1132_25310
    MSSA476:
    SAS2586a
    Mu3:
    SAHV_2687
    Mu50:
    SAV2703
    MW2:
    MW2622
    RF122:
    ST398:
    SAPIG2749
    T0131:
    SAT0131_02980 (gidA)
    TCH60:
    HMPREF0772_10484
    TW20:
    USA300_TCH1516:
    USA300HOU_2705
    VC40:
    SAVC_12385

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFRELVKQSYEDLKNLTVTWYNVIALTILVIVLSSFTTPMIGIPAGLLGGAYYLKRREE
    N315            MKFRELVKQSYEDLKNLTVTWYNVIALAMIVIVLSVVTTPIIGIPAGLLGGAYYLKRREE
    Newman          MKFRELVKQSYEDLKNLTVTWYNVIALTILVIVLSSFTTPMIGIPAGLLGGAYYLKRREE
    USA300_FPR3757  MKFRELVKQSYEDLKNLTVTWYNVIALTILVIVLSSFTTPMIGIPAGLLGGAYYLKRREE
                    ***************************:::***** .***:*******************

    COL             KGK
    N315            KGK
    Newman          KGK
    USA300_FPR3757  KGK
                    ***