From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan006480000
  • symbol?:
  • description?: XRE family transcriptional regulator

      descriptions from strain specific annotations:

    • XRE family transcriptional regulator
    • transcriptional regulator, Cro/CI family
    • Transcriptional regulator
    • helix-turn-helix family protein
    • putative transcriptional regulator
    • helix-turn-helix domain-containing protein
    • Cro/CI family transcriptional regulator
  • strand?: -
  • coordinates?: 6516727..6517296
  • synteny block?: BlockID0051870
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2644
    08BA02176:
    C248_2771
    11819-97:
    MS7_2710
    71193:
    ST398NM01_2751
    ECT-R 2:
    ECTR2_2557
    ED133:
    ED98:
    SAAV_2777
    HO 5096 0412:
    SAEMRSA15_26030
    JH1:
    SaurJH1_2785
    JH9:
    SaurJH9_2728
    JKD6008:
    SAA6008_02767
    JKD6159:
    SAA6159_02599
    LGA251:
    SARLGA251_24700
    M013:
    M013TW_2692
    MRSA252:
    SAR2791
    MSHR1132:
    SAMSHR1132_25330
    MSSA476:
    SAS2588
    Mu3:
    SAHV_2689
    Mu50:
    SAV2705
    MW2:
    MW2624
    RF122:
    SAB2582c
    ST398:
    SAPIG2751
    T0131:
    SAT0131_02988
    TCH60:
    HMPREF0772_10477
    TW20:
    SATW20_28430
    USA300_TCH1516:
    VC40:
    SAVC_12415

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNLSKQIKKYRERDGYSQEYLAEKLYVSRQSISNWENDKSLPDIHNLLMMCELFNVTLDD
    N315            MNLSKQIKKYRERDGYSQEYLAEKLYVSRQSISNWENDKSLPDIHNLLMMCELFNVTLDD
    NCTC8325        MNLSKQIKKYRERDGYSQEYLAEKLYVSRQSISNWENDKSLPDIHNLLMMCELFNVTLDD
    Newman          MNLSKQIKKYRERDGYSQEYLAEKLYVSRQSISNWENDKSLPDIHNLLMMCELFNVTLDD
    USA300_FPR3757  MNLSKQIKKYRERDGYSQEYLAEKLYVSRQSISNWENDKSLPDIHNLLMMCELFNVTLDD
                    ************************************************************

    COL             LVKGTIPFVPDIKAQRSLNLWTYVMLIFMTLAAILMGPLVVYWNWTWGVTVAIILGIGFY
    N315            LVKGTIPFVPDIKVQRSLNLWTYVMLIFMTLAAILMGPLVVYWNWTWGITVAIILGIGFY
    NCTC8325        LVKGTIPFVPDIKAQRSLNLWTYVMLIFMTLAAILMGPLVVYWNWTWGVTVAIILGIGFY
    Newman          LVKGTIPFVPDIKAQRSLNLWTYVMLIFMTLAAILMGPLVVYWNWTWGVTVAIILGIGFY
    USA300_FPR3757  LVKGTIPFVPDIKAQRSLNLWTYVMLIFMTLAAILMGPLVVYWNWTWGVTVAIILGIGFY
                    *************.**********************************:***********

    COL             ASMKIEDLKKVHKMDNYDRIVAFMNGKDPSEVQTTKARNTMTNALSIISVIGILSLIIFL
    N315            ASMKIEDLKKVHKMDNYDRIVAFMNGKDPSEVQTTKARNTMTNALSIISAIGILSLIIFL
    NCTC8325        ASMKIEDLKKVHKMDNYDRIVAFMNGKDPSEVQTTKARNTMTNALSIISVIGILSLIIFL
    Newman          ASMKIEDLKKVHKMDNYDRIVAFMNGKDPSEVQTTKARNTMTNALSIISVIGILSLIIFL
    USA300_FPR3757  ASMKIEDLKKVHKMDNYDRIVAFMNGKDPSEVQTTKARNTMTNALSIISVIGILSLIIFL
                    *************************************************.**********

    COL             SVYLANKFL
    N315            SVYMANKFL
    NCTC8325        SVYLANKFL
    Newman          SVYLANKFL
    USA300_FPR3757  SVYLANKFL
                    ***:*****