From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006481000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • Permease
  • strand?: -
  • coordinates?: 6517556..6517936
  • synteny block?: BlockID0051880
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2645
    08BA02176:
    C248_2772
    11819-97:
    MS7_2711
    71193:
    ST398NM01_2752
    ECT-R 2:
    ECTR2_2558
    ED133:
    SAOV_2748c
    ED98:
    SAAV_2778
    HO 5096 0412:
    SAEMRSA15_26040
    JH1:
    SaurJH1_2786
    JH9:
    SaurJH9_2729
    JKD6008:
    SAA6008_02768
    JKD6159:
    SAA6159_02600
    LGA251:
    SARLGA251_24710
    M013:
    M013TW_2693
    MRSA252:
    SAR2792
    MSHR1132:
    SAMSHR1132_25340
    MSSA476:
    SAS2589
    Mu3:
    SAHV_2690
    Mu50:
    SAV2706
    MW2:
    MW2625
    RF122:
    SAB2583c
    ST398:
    SAPIG2752
    T0131:
    SAT0131_02989
    TCH60:
    HMPREF0772_10476
    TW20:
    SATW20_28440
    USA300_TCH1516:
    USA300HOU_2710
    VC40:
    SAVC_12420

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----MKFFVGGFAVLLSYIVSVTLPWKEFGGIFATFPAVFLVSMFITGMQYGDKVAVHV
    N315            MKLTLMKFFVGGFAVLLSYIVSVTLPWKEFGGIFATFPAVFLVSMFITGMQYGDKVAVHV
    NCTC8325        MKLTLMKFFVGGFAVLLSYIVSVTLPWKEFGGIFATFPAVFLVSMFITGMQYGDKVAVHV
    Newman          MKLTLMKFFVGGFAVLLSYIVSVTLPWKEFGGIFATFPAVFLVSMFITGMQYGDKVAVHV
    USA300_FPR3757  MKLTLMKFFVGGFAVLLSYIVSVTLPWKEFGGIFATFPAVFLVSMFITGMQYGDKVAVHV
                         *******************************************************

    COL             SRGAVFGMTGVLVCILVTWMMLHMTHMWLISIVVGFLSWFISAVCIFEAVEFIAQKRLEK
    N315            SRGAVFGMTGVLVCILVTWMMLHMTHMWLISIIVGFLSWFISAVCIFEAVEFIAQKRLEK
    NCTC8325        SRGAVFGMTGVLVCILVTWMMLHMTHMWLISIVVGFLSWFISAVCIFEAVEFIAQKRLEK
    Newman          SRGAVFGMTGVLVCILVTWMMLHMTHMWLISIVVGFLSWFISAVCIFEAVEFIAQKRLEK
    USA300_FPR3757  SRGAVFGMTGVLVCILVTWMMLHMTHMWLISIVVGFLSWFISAVCIFEAVEFIAQKRLEK
                    ********************************:***************************

    COL             HSWKAGKSNSK
    N315            HSWKAGKSNSK
    NCTC8325        HSWKAGKSNSK
    Newman          HSWKAGKSNSK
    USA300_FPR3757  HSWKAGKSNSK
                    ***********