From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006482000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • Permease
  • strand?: -
  • coordinates?: 6518019..6518372
  • synteny block?: BlockID0051890
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2646
    08BA02176:
    C248_2773
    11819-97:
    MS7_2712
    71193:
    ST398NM01_2753
    ECT-R 2:
    ECTR2_2559
    ED133:
    SAOV_2749c
    ED98:
    SAAV_2779
    HO 5096 0412:
    SAEMRSA15_26050
    JH1:
    SaurJH1_2787
    JH9:
    SaurJH9_2730
    JKD6008:
    SAA6008_02769
    JKD6159:
    SAA6159_02601
    LGA251:
    SARLGA251_24720
    M013:
    M013TW_2694
    MRSA252:
    SAR2793
    MSHR1132:
    SAMSHR1132_25350
    MSSA476:
    SAS2590
    Mu3:
    SAHV_2691
    Mu50:
    SAV2707
    MW2:
    MW2626
    RF122:
    SAB2584c
    ST398:
    SAPIG2753
    T0131:
    SAT0131_02990
    TCH60:
    HMPREF0772_10475
    TW20:
    SATW20_28450
    USA300_TCH1516:
    USA300HOU_2711
    VC40:
    SAVC_12425

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFSIGSAILHFVIGGIAVALASIIADKVGGKLGGIIATMPAVFLAAIIALALDHRGTQLV
    N315            MFSIGSAILHFVIGGIAVALASIIADKVGGKLGGIIATMPAVFLAAIIALALDHRGTQLV
    NCTC8325        MFSIGSAILHFVIGGIAVALASIIADKVGGKLGGIIATMPAVFLAAIIALALDHRGTQLV
    Newman          MFSIGSAILHFVIGGIAVALASIIADKVGGKLGGIIATMPAVFLAAIIALALDHRGTQLV
    USA300_FPR3757  MFSIGSAILHFVIGGIAVALASIIADKVGGKLGGIIATMPAVFLAAIIALALDHRGTQLV
                    ************************************************************

    COL             EMSMNLSTGAIVGILSCILTVFLTSLYIKHKGYRKGAIFTVVCWFVISLAIFSIRHL
    N315            EMSMNLSTGAIVGILSCILTVFLTSLYIKHKGYRKGAIFTVVCWFVISLAIFSIRHL
    NCTC8325        EMSMNLSTGAIVGILSCILTVFLTSLYIKHKGYRKGAIFTVVCWFVISLAIFSIRHL
    Newman          EMSMNLSTGAIVGILSCILTVFLTSLYIKHKGYRKGAIFTVVCWFVISLAIFSIRHL
    USA300_FPR3757  EMSMNLSTGAIVGILSCILTVFLTSLYIKHKGYRKGAIFTVVCWFVISLAIFSIRHL
                    *********************************************************