From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006486000
  • symbol?: noc
  • description?: DNA-binding protein Spo0j-like protein

      descriptions from strain specific annotations:

    • DNA-binding protein Spo0j-like protein
    • parB-like partition protein
    • ParB family chromosome partioning protein
    • Chromosome (plasmid) partitioning protein ParB
    • protein yyaA
    • ParB family chromosome partioning protein ParB family
    • chromosome partioning ParB family protein
    • transcriptional regulator
    • nucleoid occlusion protein
    • chromosome (plasmid) partitioning protein ParB/ Stage 0 sporulation protein J
    • ParB family nucleoid occlusion protein, Noc
    • chromosome partioning protein, ParB family
    • putative DNA-binding protein
    • ParB family partitioning protein
    • stage 0 DNA-binding protein
  • strand?: -
  • coordinates?: 6520447..6521286
  • synteny block?: BlockID0051930
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2648 (parB)
    08BA02176:
    C248_2774
    11819-97:
    MS7_2713 (noc)
    71193:
    ST398NM01_2754
    ECT-R 2:
    ECTR2_2560
    ED133:
    SAOV_2750c
    ED98:
    SAAV_2780
    HO 5096 0412:
    SAEMRSA15_26070
    JH1:
    SaurJH1_2788
    JH9:
    SaurJH9_2731
    JKD6008:
    SAA6008_02770 (noc)
    JKD6159:
    SAA6159_02602 (noc)
    LGA251:
    SARLGA251_24730 (yyaA)
    M013:
    M013TW_2695
    MRSA252:
    SAR2795
    MSHR1132:
    SAMSHR1132_25360
    MSSA476:
    SAS2591
    Mu3:
    SAHV_2693
    Mu50:
    SAV2709
    MW2:
    MW2627
    RF122:
    SAB2585c
    ST398:
    SAPIG2754
    T0131:
    SAT0131_02991
    TCH60:
    HMPREF0772_10473
    TW20:
    SATW20_28470 (yyaA)
    USA300_TCH1516:
    USA300HOU_2712
    VC40:
    SAVC_12435

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKPFSKLFGLKNKDDIIGHIEEDRNSNVESIQIERIVPNRYQPRQVFEPNKIKELAESI
    N315            MKKPFSKLFGLKNKDDIIGHIEEDRNSNVESIQIERIVPNRYQPRQVFEPNKIKELAESI
    NCTC8325        MKKPFSKLFGLKNKDDIIGHIEEDRNSNVESIQIERIVPNRYQPRQVFEPNKIKELAESI
    Newman          MKKPFSKLFGLKNKDDIIGHIEEDRNSNVESIQIERIVPNRYQPRQVFEPNKIKELAESI
    USA300_FPR3757  MKKPFSKLFGLKNKDDIIGHIEEDRNSNVESIQIERIVPNRYQPRQVFEPNKIKELAESI
                    ************************************************************

    COL             HEHGLLQPIVVRPIEEDMFEIIAGERRFRAIQSLNLPQADVIIRDMDDEETAVVALIENI
    N315            HEHGLLQPIVVRPIEEDMFEIIAGERRFRAIQSLNLPQADVIIRDMDDEETAVVALIENI
    NCTC8325        HEHGLLQPIVVRPIEEDMFEIIAGERRFRAIQSLNLPQADVIIRDMDDEETAVVALIENI
    Newman          HEHGLLQPIVVRPIEEDMFEIIAGERRFRAIQSLNLPQADVIIRDMDDEETAVVALIENI
    USA300_FPR3757  HEHGLLQPIVVRPIEEDMFEIIAGERRFRAIQSLNLPQADVIIRDMDDEETAVVALIENI
                    ************************************************************

    COL             QRENLSVVEEAEAYKKLLEIGDTTQSELAKSLGKSQSFIANKLRLLKLAPKVLLRLREGK
    N315            QRENLSVVEEAEAYKKLLEIGDTTQSELAKSLGKSQSFIANKLRLLKLAPKVLLRLREGK
    NCTC8325        QRENLSVVEEAEAYKKLLEIGDTTQSELAKSLGKSQSFIANKLRLLKLAPKVLLRLREGK
    Newman          QRENLSVVEEAEAYKKLLEIGDTTQSELAKSLGKSQSFIANKLRLLKLAPKVLLRLREGK
    USA300_FPR3757  QRENLSVVEEAEAYKKLLEIGDTTQSELAKSLGKSQSFIANKLRLLKLAPKVLLRLREGK
                    ************************************************************

    COL             ITERHARAVLSLSDSEQEALIEQVIAQKLNVKQTEDRVRQKTGPEKVKAQNLRFAQDVTQ
    N315            ITERHARAVLSLSDSEQEALIEQVIAQKLNVKQTEDRVRQKTGPEKVKAQNLRFAQDVTQ
    NCTC8325        ITERHARAVLSLSDSEQEALIEQVIAQKLNVKQTEDRVRQKTGPEKVKAQNLRFAQDVTQ
    Newman          ITERHARAVLSLSDSEQEALIEQVIAQKLNVKQTEDRVRQKTGPEKVKAQNLRFAQDVTQ
    USA300_FPR3757  ITERHARAVLSLSDSEQEALIEQVIAQKLNVKQTEDRVRQKTGPEKVKAQNLRFAQDVTQ
                    ************************************************************

    COL             ARDEVGKSIQAIQQTGLHVEHKDKDHEDYYEIKIRIYKR
    N315            ARDEVGKSIQAIQQTGLHVEHKDKDHEDYYEIKIRIYKR
    NCTC8325        ARDEVGKSIQAIQQTGLHVEHKDKDHEDYYEIKIRIYKR
    Newman          ARDEVGKSIQAIQQTGLHVEHKDKDHEDYYEIKIRIYKR
    USA300_FPR3757  ARDEVGKSIQAIQQTGLHVEHKDKDHEDYYEIKIRIYKR
                    ***************************************