From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006490000
  • symbol?: rnpA
  • description?: ribonuclease P

      descriptions from strain specific annotations:

    • ribonuclease P
    • ribonuclease P protein component
  • strand?: -
  • coordinates?: 6525580..6525927
  • synteny block?: BlockID0051970
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2739 (rnpA)
    N315:
    SA2502 (rnpA)
    NCTC8325:
    Newman:
    NWMN_2613 (rnpA)
    USA300_FPR3757:
    04-02981:
    SA2981_2652 (rnpA)
    08BA02176:
    C248_2778 (rnpA)
    11819-97:
    MS7_2717 (rnpA)
    71193:
    ST398NM01_2758
    ECT-R 2:
    ECTR2_2564 (rnpA)
    ED133:
    ED98:
    SAAV_2784 (rnpA)
    HO 5096 0412:
    SAEMRSA15_26110 (rnpA)
    JH1:
    SaurJH1_2792 (rnpA)
    JH9:
    SaurJH9_2735 (rnpA)
    JKD6008:
    SAA6008_02774 (rnpA)
    JKD6159:
    SAA6159_02606 (rnpA)
    LGA251:
    SARLGA251_24770 (rnpA)
    M013:
    M013TW_2699
    MRSA252:
    SAR2799 (rnpA)
    MSHR1132:
    SAMSHR1132_25400
    MSSA476:
    SAS2595 (rnpA)
    Mu3:
    SAHV_2697 (rnpA)
    Mu50:
    SAV2713 (rnpA)
    MW2:
    MW2631 (rnpA)
    RF122:
    SAB2589c (rnpA)
    ST398:
    SAPIG2758 (rnpA)
    T0131:
    SAT0131_02995 (nth)
    TCH60:
    HMPREF0772_10469 (rnpA)
    TW20:
    SATW20_28510 (rnpA)
    USA300_TCH1516:
    USA300HOU_2716 (rnpA)
    VC40:
    SAVC_12455 (rnpA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MEKAYRIKKNADFQRIYKKGHSVANRQFVVYTCNNKEIDHFRLGISVSKKLGNAVLR
    N315            ---MEKAYRIKKNADFQRIYKKGHSVANRQFVVYTCNNKEIDHFRLGISVSKKLGNAVLR
    NCTC8325        -MLLEKAYRIKKNADFQRIYKKGHSVANRQFVVYTCNNKEIDHFRLGISVSKKLGNAVLR
    Newman          MMLLEKAYRIKKNADFQRIYKKGHSVANRQFVVYTCNNKEIDHFRLGISVSKKLGNAVLR
    USA300_FPR3757  -MLLEKAYRIKKNADFQRIYKKGHSVANRQFVVYTCNNKEIDHFRLGISVSKKLGNAVLR
                       :********************************************************

    COL             NKIKRAIRENFKVHKSHILAKDIIVIARQPAKDMTTLQIQNSLEHVLKIAKVFNKKIK
    N315            NKIKRAIRENFKVHKSHILAKDIIVIARQPAKDMTTLQIQNSLEHVLKIAKVFNKKIK
    NCTC8325        NKIKRAIRENFKVHKSHILAKDIIVIARQPAKDMTTLQIQNSLEHVLKIAKVFNKKIK
    Newman          NKIKRAIRENFKVHKSHILAKDIIVIARQPAKDMTTLQIQNSLEHVLKIAKVFNKKIK
    USA300_FPR3757  NKIKRAIRENFKVHKSHILAKDIIVIARQPAKDMTTLQIQNSLEHVLKIAKVFNKKIK
                    **********************************************************