From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006491000
  • symbol?: rpmH
  • description?: 50S ribosomal protein L34

      descriptions from strain specific annotations:

    • 50S ribosomal protein L34
    • rpmH
  • strand?: -
  • coordinates?: 6526056..6526193
  • synteny block?: BlockID0051980
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2740 (rpmH)
    N315:
    SAS093 (rpmH)
    NCTC8325:
    Newman:
    NWMN_2614 (rpmH)
    USA300_FPR3757:
    04-02981:
    SA2981_2653 (rpmH)
    08BA02176:
    C248_2779
    11819-97:
    MS7_2718 (rpmH)
    71193:
    ST398NM01_2759
    ECT-R 2:
    ECTR2_2565 (rpmH)
    ED133:
    SAOV_2754c
    ED98:
    SAAV_2785 (rpmH)
    HO 5096 0412:
    SAEMRSA15_26120 (rpmH)
    JH1:
    SaurJH1_2793 (rpmH)
    JH9:
    JKD6008:
    SAA6008_02775 (rpmH)
    JKD6159:
    SAA6159_02607 (rpmH)
    LGA251:
    SARLGA251_24780 (rpmH)
    M013:
    M013TW_2700
    MRSA252:
    SAR2800 (rpmH)
    MSHR1132:
    SAMSHR1132_25410
    MSSA476:
    SAS2596 (rpmH)
    Mu3:
    SAHV_2698 (rpmH)
    Mu50:
    SAV2714 (rpmH)
    MW2:
    MW2632 (rpmH)
    RF122:
    SAB2590c (rpmH)
    ST398:
    SAPIG2759 (rpmH)
    T0131:
    SAT0131_02996 (dnaD)
    TCH60:
    HMPREF0772_10468 (rpmH)
    TW20:
    SATW20_28520 (rpmH)
    USA300_TCH1516:
    USA300HOU_2717 (rpmH)
    VC40:
    SAVC_12460 (rpmH)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVKRTYQPNKRKHSKVHGFRKRMSTKNGRKVLARRRRKGRKVLSA
    N315            MVKRTYQPNKRKHSKVHGFRKRMSTKNGRKVLARRRRKGRKVLSA
    NCTC8325        MVKRTYQPNKRKHSKVHGFRKRMSTKNGRKVLARRRRKGRKVLSA
    Newman          MVKRTYQPNKRKHSKVHGFRKRMSTKNGRKVLARRRRKGRKVLSA
    USA300_FPR3757  MVKRTYQPNKRKHSKVHGFRKRMSTKNGRKVLARRRRKGRKVLSA
                    *********************************************