From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0043
  • pan locus tag?: SAUPAN000663000
  • symbol: SAUSA300_0043
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0043
  • symbol: SAUSA300_0043
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 54981..55154
  • length: 174
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    GTGCCACACGGCAAACTTTTAGAAACAGATTTACCTTTCAATAGAAACGATGTTATTTAT
    GTAGACTGTCAGTCTGGCATTAGAAGTTCTATAGCTATTGGTATTTTAGAACACAAAGGT
    TATCACAACATTATTAATGTAAACGAAGGTTACAAAGATATATACCTTTCTTAA
    60
    120
    174

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0043
  • symbol: SAUSA300_0043
  • description: hypothetical protein
  • length: 57
  • theoretical pI: 6.2209
  • theoretical MW: 6475.31
  • GRAVY: -0.236842

Function[edit | edit source]

  • TIGRFAM:
    phage shock operon rhodanese PspE (TIGR02981; EC 2.8.1.1; HMM-score: 19.7)
  • TheSEED  :
    • Polysulfide binding protein
    • Zn-dependent hydroxyacylglutathione hydrolase
  • PFAM:
    Phosphatase (CL0031) Rhodanese; Rhodanese-like domain (PF00581; HMM-score: 18)
    and 1 more
    SH3 (CL0010) SH3_9; Variant SH3 domain (PF14604; HMM-score: 12.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.014562
    • TAT(Tat/SPI): 0.001132
    • LIPO(Sec/SPII): 0.003227
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MPHGKLLETDLPFNRNDVIYVDCQSGIRSSIAIGILEHKGYHNIINVNEGYKDIYLS

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]