From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0068 [new locus tag: SAUSA300_RS14980 ]
  • pan locus tag?: SAUPAN000817000
  • symbol: SAUSA300_0068
  • pan gene symbol?:
  • synonym:
  • product: cadmium-exporting ATPase, truncation

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_0068 [new locus tag: SAUSA300_RS14980 ]
  • symbol: SAUSA300_0068
  • product: cadmium-exporting ATPase, truncation
  • replicon: chromosome
  • strand: -
  • coordinates: 76073..76225
  • length: 153
  • essential: unknown

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    TTGCAACAGAACCTATATTTTGCTATAATTATTAAATTAATTGCCTTTGTGTTAGTATTC
    CCTGGATTACTAACACTTTGGTTAGCTGTTCTAAGTGATACAGGTGCAGCAATATTAGTT
    ATATTAAATTCATTACGTTTATTAAAAAAATAA
    60
    120
    153

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_0068 [new locus tag: SAUSA300_RS14980 ]
  • symbol: SAUSA300_0068
  • description: cadmium-exporting ATPase, truncation
  • length: 50
  • theoretical pI: 10.6364
  • theoretical MW: 5569.89
  • GRAVY: 1.424

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundscadmium-translocating P-type ATPase (TIGR01512; EC 3.6.3.3; HMM-score: 38.6)
    heavy metal translocating P-type ATPase (TIGR01525; EC 3.6.3.-; HMM-score: 27.9)
  • TheSEED:  
    RespirationElectron accepting reactionsTerminal cytochrome C oxidases Copper-translocating P-type ATPase (EC 3.6.3.4) 
    Virulence, Disease and DefenseResistance to antibiotics and toxic compoundsCopper homeostasis Copper-translocating P-type ATPase (EC 3.6.3.4) 
    CBSS-196620.1.peg.2477 Copper-translocating P-type ATPase (EC 3.6.3.4) 
    CBSS-196620.1.peg.2477 Lead, cadmium, zinc and mercury transporting ATPase (EC 3.6.3.3) (EC 3.6.3.5) 
  • PFAM:
    no clan definedPDR_assoc; Plant PDR ABC transporter associated (PF08370; HMM-score: 12.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 9.99
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.131
    • Ymax_pos: 11
    • Cmax: 0.195
    • Cmax_pos: 37
    • Smax: 0.232
    • Smax_pos: 4
    • Smean: 0.176
    • D: 0.148
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MQQNLYFAIIIKLIAFVLVFPGLLTLWLAVLSDTGAAILVILNSLRLLKK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_0068 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]