From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0968 [new locus tag: SAUSA300_RS05205 ]
  • pan locus tag?: SAUPAN003279000
  • symbol: purC
  • pan gene symbol?: purC
  • synonym:
  • product: phosphoribosylaminoimidazole-succinocarboxamide synthase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_0968 [new locus tag: SAUSA300_RS05205 ]
  • symbol: purC
  • product: phosphoribosylaminoimidazole-succinocarboxamide synthase
  • replicon: chromosome
  • strand: +
  • coordinates: 1061044..1061748
  • length: 705
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGACATTATTATATGAAGGAAAAGCGAAGCGCATTTTCTCAACAAATCAAGAAAATGAA
    TTAAGAGTTGAATATAAAGATGAAGTTACTGCTGGAAACGGGGCTAAGAAAGACACAATG
    GCAGGTAAGGGGCGATTAAATAATCAAATTACTTCTATTATATTTAAATATTTACAAGAA
    AATGGAATAGAAAGTCACTTTATTAAACAATTATCTGAAACAGAACAATTAGTTAAGCCT
    GTGAAAATAATTCCATTAGAAGTAGTTGTTCGTAATATTGCTAGTGGATCTATTACAAAG
    CGTTTAGGTTTTGAAAATGGTGAAGTTTTTAGAGAACCACTTGTAGAATTTTTCTATAAA
    AATGATGCGTTAAATGATCCGTTGATAACGGATGACCATGTTAAATTGCTCAATATAGCA
    TCAGATGAAGATATTGAAATACTAAAATCCAAAGCATTAAAGATTAATAATGTGTTGAAA
    CAATTAATGGATGCTATGAATTTAAAATTAGTAGATTTTAAAATCGAATTTGGAAAGACT
    GAGACTGGTCAAATTTTGTTAGCGGATGAAATATCTCCAGATACATGTCGAATTTGGGAT
    AAAGCTACCAATGCAAACTTTGATAAAGATGTATATAGAAATAACACTGGATCACTGATT
    GAAACATATCAAATATTTTTAAACAAATTGGAGGATTTAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    705

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_0968 [new locus tag: SAUSA300_RS05205 ]
  • symbol: PurC
  • description: phosphoribosylaminoimidazole-succinocarboxamide synthase
  • length: 234
  • theoretical pI: 5.07088
  • theoretical MW: 26692.4
  • GRAVY: -0.379915

Function[edit source | edit]

  • reaction:
    EC 6.3.2.6?  ExPASy
    Phosphoribosylaminoimidazolesuccinocarboxamide synthaseATP + 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate + L-aspartate = ADP + phosphate + (S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamido)succinate
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisphosphoribosylaminoimidazolesuccinocarboxamide synthase (TIGR00081; EC 6.3.2.6; HMM-score: 236.4)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisphosphoribosylaminoimidazole-succinocarboxamide synthase (TIGR02735; EC 6.3.2.6; HMM-score: 26.5)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 16.1)
  • TheSEED:  
    Nucleosides and NucleotidesPurinesDe Novo Purine Biosynthesis Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) 
  • PFAM:
    no clan definedSAICAR_synt; SAICAR synthetase (PF01259; HMM-score: 212.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.128
    • Ymax_pos: 11
    • Cmax: 0.116
    • Cmax_pos: 23
    • Smax: 0.238
    • Smax_pos: 1
    • Smean: 0.143
    • D: 0.133
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTLLYEGKAKRIFSTNQENELRVEYKDEVTAGNGAKKDTMAGKGRLNNQITSIIFKYLQENGIESHFIKQLSETEQLVKPVKIIPLEVVVRNIASGSITKRLGFENGEVFREPLVEFFYKNDALNDPLITDDHVKLLNIASDEDIEILKSKALKINNVLKQLMDAMNLKLVDFKIEFGKTETGQILLADEISPDTCRIWDKATNANFDKDVYRNNTGSLIETYQIFLNKLEDLK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]