From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1436 [new locus tag: SAUSA300_RS07835 ]
  • pan locus tag?: SAUPAN001316000
  • symbol: SAUSA300_1436
  • pan gene symbol?:
  • synonym:
  • product: phiSLT ORF144-like protein lipoprotein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_1436 [new locus tag: SAUSA300_RS07835 ]
  • symbol: SAUSA300_1436
  • product: phiSLT ORF144-like protein lipoprotein
  • replicon: chromosome
  • strand: +
  • coordinates: 1588902..1589336
  • length: 435
  • essential: unknown

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAAAAAGTAATCGGACTGCTACTAGTAAGTACATTAGCTTTAACAGCTTGTGGTGAA
    AAAGAAAAACCAAAAAAAGAAGAAAATAAAAAGTCACAAACACAAAATCACAAAGATAGC
    AAACCAAAAACGCAACAAGAAAAAATGAAAAAAGTTGAAGATAAAAATCCACCTAATAAT
    AGCATACAAAATAATTCAAACAATCAAAACCAATCACAAAACAATCAACTTAATAATAAT
    TCAGATCCATCTAATAATACTCCTGCAAATATAAATGAAAACGATTCACAAAATACTAAT
    TTAAATGATGAGTATGTCGTTTCGCCTGGCTGGACTAAAGATGAACAGGCTAAAGCTTTT
    GAAGAGTACAAAAAAGGAAAAGAAGAGGAAGCAAGAGCTGGTGCTAGCGCAGTACCAGGA
    GCCAATATTAACTAA
    60
    120
    180
    240
    300
    360
    420
    435

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_1436 [new locus tag: SAUSA300_RS07835 ]
  • symbol: SAUSA300_1436
  • description: phiSLT ORF144-like protein lipoprotein
  • length: 144
  • theoretical pI: 8.4454
  • theoretical MW: 15995.3
  • GRAVY: -1.50833

Function[edit source | edit]

  • TIGRFAM:
    Sec region non-globular protein (TIGR04420; HMM-score: 15.2)
    mycoides cluster lipoprotein, LppA/P72 family (TIGR03490; HMM-score: 12.2)
    and 11 more
    Genetic information processingProtein fateProtein and peptide secretion and traffickingouter membrane assembly lipoprotein YfiO (TIGR03302; HMM-score: 12.1)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalamincobaltochelatase, CobT subunit (TIGR01651; EC 6.6.1.2; HMM-score: 9.4)
    Cellular processesCellular processesChemotaxis and motilityflagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 7)
    MetabolismTransport and binding proteinsCations and iron carrying compoundscation transporter family protein (TIGR00860; HMM-score: 6.7)
    Cellular processesCellular processesSporulation and germinationsporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 6.6)
    cobaltochelatase subunit (TIGR02442; EC 6.6.1.2; HMM-score: 6.1)
    MetabolismEnergy metabolismTCA cycledihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 5.7)
    pullulanase, extracellular (TIGR02102; HMM-score: 5.4)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsferrous iron transport protein B (TIGR00437; HMM-score: 4.6)
    MetabolismTransport and binding proteinsCations and iron carrying compoundspotassium uptake protein, Trk family (TIGR00934; HMM-score: 2.5)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsK+-dependent Na+/Ca+ exchanger (TIGR00927; HMM-score: 2.1)
  • TheSEED:  
    Phage protein 
  • PFAM:
    LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 13.6)
    no clan definedDUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 13.4)
    DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 13)
    FAM76; FAM76 protein (PF16046; HMM-score: 12.7)
    and 11 more
    DMT (CL0184) Zip; ZIP Zinc transporter (PF02535; HMM-score: 9.2)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 8.6)
    no clan definedMed24_N; Mediator complex subunit 24 N-terminal (PF11277; HMM-score: 6.7)
    FAM60A; Protein Family FAM60A (PF15396; HMM-score: 6.7)
    SLC12; Solute carrier family 12 (PF03522; HMM-score: 6.6)
    CPA_AT (CL0064) Mem_trans; Membrane transport protein (PF03547; HMM-score: 5.7)
    no clan definedCLN3; CLN3 protein (PF02487; HMM-score: 5.5)
    FUSC (CL0307) ALMT; Aluminium activated malate transporter (PF11744; HMM-score: 5.5)
    no clan definedLMBR1; LMBR1-like membrane protein (PF04791; HMM-score: 5.4)
    GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 5.4)
    no clan definedV_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 5.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.82
    • Extracellular Score: 9.13
    • Internal Helices: 0
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: ALTACGE
  • SignalP: Signal peptide length 23 aa
    • Ymax: 0.397
    • Ymax_pos: 23
    • Cmax: 0.194
    • Cmax_pos: 23
    • Smax: 0.94
    • Smax_pos: 1
    • Smean: 0.838
    • D: 0.569
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKVIGLLLVSTLALTACGEKEKPKKEENKKSQTQNHKDSKPKTQQEKMKKVEDKNPPNNSIQNNSNNQNQSQNNQLNNNSDPSNNTPANINENDSQNTNLNDEYVVSPGWTKDEQAKAFEEYKKGKEEEARAGASAVPGANIN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]