From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1741
  • pan locus tag?: SAUPAN004517000
  • symbol: SAUSA300_1741
  • pan gene symbol?:
  • synonym:
  • product: putative lipoprotein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_1741
  • symbol: SAUSA300_1741
  • product: putative lipoprotein
  • replicon: chromosome
  • strand: +
  • coordinates: 1924777..1924932
  • length: 156
  • essential: unknown

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGAAATTCAAAGCTATCGTTGCAATCACATTATCATTGTCACTATTAACTGCCTGTGGT
    GCTAATCAACATAAAGAAAATAGTAGTAAATCAAATGACACTAATAAAAAGACGCAACAA
    ACTGACAACACTACACAGTCAAATACAGAAAAGTAA
    60
    120
    156

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_1741
  • symbol: SAUSA300_1741
  • description: putative lipoprotein
  • length: 51
  • theoretical pI: 10.0523
  • theoretical MW: 5570.17
  • GRAVY: -0.931373

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesSporulation and germinationsporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 20.6)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingouter membrane assembly lipoprotein YfiO (TIGR03302; HMM-score: 13.3)
  • TheSEED:  
    Hypothetical protein SAV1801 
  • PFAM:
    no clan definedETRAMP; Malarial early transcribed membrane protein (ETRAMP) (PF09716; HMM-score: 13.1)
    LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 11.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.82
    • Extracellular Score: 9.13
    • Internal Helices: 0
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: -0.33
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: SLLTACG
  • SignalP: Signal peptide length 21 aa
    • Ymax: 0.449
    • Ymax_pos: 21
    • Cmax: 0.212
    • Cmax_pos: 21
    • Smax: 0.97
    • Smax_pos: 19
    • Smean: 0.949
    • D: 0.644
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKFKAIVAITLSLSLLTACGANQHKENSSKSNDTNKKTQQTDNTTQSNTEK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]