From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1925 [new locus tag: SAUSA300_RS10565 ]
  • pan locus tag?: SAUPAN005042000
  • symbol: SAUSA300_1925
  • pan gene symbol?:
  • synonym:
  • product: phiPVL ORF17-like protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_1925 [new locus tag: SAUSA300_RS10565 ]
  • symbol: SAUSA300_1925
  • product: phiPVL ORF17-like protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2090666..2090962
  • length: 297
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    TTGGGGTGGTTCAAAAAACACGAACATGAATGGCGCATCAGAAGGTTAGAAGAGAATGAT
    AAAACAATGCTCAGCACACTCAATGAAATTAAATTAGGTCAAAAAACCCAAGAGCAAGTT
    AACATTAAATTAGATAAAACCTTAGATGCTATTCAAAAAGAAAGAGAAATAGATGAAAAG
    AATAAGAAAGAAAATGATAAGAACATACGTGATATGAAAATGTGGGTGCTTGGTTTAGTT
    GGGACAATATTTGGATCGCTAATTATAGCATTATTGCGTATGCTTATGGGCATATAA
    60
    120
    180
    240
    297

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_1925 [new locus tag: SAUSA300_RS10565 ]
  • symbol: SAUSA300_1925
  • description: phiPVL ORF17-like protein
  • length: 98
  • theoretical pI: 10.0627
  • theoretical MW: 11665.7
  • GRAVY: -0.627551

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesSporulation and germinationstage III sporulation protein AB (TIGR02833; HMM-score: 16.1)
  • TheSEED:  
    Hypothetical protein, SLT orf99 homolog [SA bacteriophages 11, Mu50B] 
  • PFAM:
    no clan definedDUF2951; Protein of unknown function (DUF2951) (PF11166; HMM-score: 185.3)
    ClpP_crotonase (CL0127) Peptidase_S49_N; Peptidase family S49 N-terminal (PF08496; HMM-score: 15.2)
    no clan definedBicD; Microtubule-associated protein Bicaudal-D (PF09730; HMM-score: 14.3)
    RAMP4; Ribosome associated membrane protein RAMP4 (PF06624; HMM-score: 12.4)
    DUF1191; Protein of unknown function (DUF1191) (PF06697; HMM-score: 11.7)
    XhlA; Haemolysin XhlA (PF10779; HMM-score: 9.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.78
    • Cytoplasmic Membrane Score: 8.16
    • Cellwall Score: 0.06
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: Intracellular /TMH start AFTER 60
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: Possibly Sec-
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.113
    • Ymax_pos: 66
    • Cmax: 0.105
    • Cmax_pos: 41
    • Smax: 0.151
    • Smax_pos: 58
    • Smean: 0.102
    • D: 0.109
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MGWFKKHEHEWRIRRLEENDKTMLSTLNEIKLGQKTQEQVNIKLDKTLDAIQKEREIDEKNKKENDKNIRDMKMWVLGLVGTIFGSLIIALLRMLMGI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]